Record in detail


General Info

  • lamp_id:L01A000318
  • Name:PAN1_PANIM
  • FullName:Pandinin-1
  • Source:Pandinus imperator
  • Mass:4799.5 Da
  • Sequence Length:44 aa
  • Isoelectric Point:10.49
  • Activity:Antibacterial
  • Sequence
        GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT
  • Function:Disrupts cell membranes through formation of pores. Strong antimicrobial activity against Gram-positive bacteria B.subtilis, S.epidermidis, E.faecalis and S.aureus. Less active against Gram-negative bacteria P.aeruginosa and E.coli. Has no antifungal or hemolytic activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000318    From 1 To 44 E-value: 6e-20 Score: 87.8
        GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT
  • 2. L01A000338    From 1 To 44 E-value: 0.000000000000002 Score: 72.8
        GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS
  • 3. L12A08840|    From 23 To 66 E-value: 0.000000000000002 Score: 72.8
        GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS
  • 4. L01A002450    From 1 To 44 E-value: 0.000000000000006 Score: 71.2
        GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS
  • 5. L01A000337    From 1 To 44 E-value: 0.000000000000007 Score: 71.2
        GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS

Structure

  •   Domains
  •   1  Name:Antimicrobial_7    Interpro Link:IPR012526
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  P.aeruginosa  MIC:  99.83 μg/ml  (20.8001 μM)  
  •   2  Target:  E. coli  MIC:  99.83 μg/ml  (20.8001 μM)  
  •   3  Target:  Ent. faecalis  MIC:  6.24 μg/ml  (1.30014 μM)  
  •   4  Target:  C. albicans  MIC:  99.83 μg/ml  (20.8001 μM)  
  •   5  Target:  B. subtilis  MIC:  24.96 μg/ml  (5.20054 μM)  
  •   6  Target:  Staph. epidermidis  MIC:  24.96 μg/ml  (5.20054 μM)  
  •   7  Target:  Staph. aureus  MIC:  12.48 μg/ml  (2.60027 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  He W.,Barnham K.J.,Villegas E.,Escoubas P.,Corzo G.,
  •   Title:Characterization of unique amphipathic antimicrobial peptides from venom of the scorpion Pandinus imperator.
  •   Journal:Biochem. J., 2001, 359, 35-45  [MEDLINE:21448116]
  •   [2]  Iwashita T.,Darbon H.,Nakajima T.,Ferrat G.,Nomura K.,
  •   Title:Induction of morphological changes in model lipid membranes and the mechanism of membrane disruption by a large scorpion-derived pore-forming peptide.
  •   Journal:Biophys. J., 2005, 89, 4067-4080  [PubMed:16199510]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: