Record in detail
General Info
- lamp_id:L01A000318
- Name:PAN1_PANIM
- FullName:Pandinin-1
- Source:Pandinus imperator
- Mass:4799.5 Da
- Sequence Length:44 aa
- Isoelectric Point:10.49
- Activity:Antibacterial
- Sequence
GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT - Function:Disrupts cell membranes through formation of pores. Strong antimicrobial activity against Gram-positive bacteria B.subtilis, S.epidermidis, E.faecalis and S.aureus. Less active against Gram-negative bacteria P.aeruginosa and E.coli. Has no antifungal or hemolytic activity.
Cross-Linking
- Cross-linking
- 1 Database:APD 562
- 2 Database:CAMP CAMPSQ295
- 3 Database:DBAASP 947
- 4 Database:dbAMP dbAMP_03236
- 5 Database:DRAMP DRAMP03723
- 6 Database:SATPdb satpdb24629
- 7 Database:Uniprot P83239
- 8 Database:AMD PAN1_PANIM
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000318 From 1 To 44 E-value: 6e-20 Score: 87.8
GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT - 2. L01A000338 From 1 To 44 E-value: 0.000000000000002 Score: 72.8
GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS - 3. L12A08840| From 23 To 66 E-value: 0.000000000000002 Score: 72.8
GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS - 4. L01A002450 From 1 To 44 E-value: 0.000000000000006 Score: 71.2
GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS - 5. L01A000337 From 1 To 44 E-value: 0.000000000000007 Score: 71.2
GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS
Activity
- Antibacterial Activities
- 1 Target: P.aeruginosa MIC: 99.83 μg/ml (20.8001 μM)
- 2 Target: E. coli MIC: 99.83 μg/ml (20.8001 μM)
- 3 Target: Ent. faecalis MIC: 6.24 μg/ml (1.30014 μM)
- 4 Target: C. albicans MIC: 99.83 μg/ml (20.8001 μM)
- 5 Target: B. subtilis MIC: 24.96 μg/ml (5.20054 μM)
- 6 Target: Staph. epidermidis MIC: 24.96 μg/ml (5.20054 μM)
- 7 Target: Staph. aureus MIC: 12.48 μg/ml (2.60027 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] He W.,Barnham K.J.,Villegas E.,Escoubas P.,Corzo G.,
- Title:Characterization of unique amphipathic antimicrobial peptides from venom of the scorpion Pandinus imperator.
- Journal:Biochem. J., 2001, 359, 35-45 [MEDLINE:21448116]
- [2] Iwashita T.,Darbon H.,Nakajima T.,Ferrat G.,Nomura K.,
- Title:Induction of morphological changes in model lipid membranes and the mechanism of membrane disruption by a large scorpion-derived pore-forming peptide.
- Journal:Biophys. J., 2005, 89, 4067-4080 [PubMed:16199510]
Comments
- Comments
No comments found on LAMP database