Record in detail


General Info

  • lamp_id:L01A000330
  • Name:Parabutoporin
  • FullName:Parabutoporin
  • Source:Parabuthus schlechteri
  • Mass:4994.9 Da
  • Sequence Length:45 aa
  • Isoelectric Point:10.75
  • Activity:Antibacterial, Antifungal
  • Sequence
        FKLGSFLKKAWKSKLAKKLRAKGKEMLKDYAKGLLEGGSEEVPGQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000330    From 1 To 45 E-value: 3e-19 Score: 85.9
        FKLGSFLKKAWKSKLAKKLRAKGKEMLKDYAKGLLEGGSEEVPGQ
  • 2. L12A02311|    From 1 To 37 E-value: 0.0000000002 Score: 56.2
        FRFGSFLKKVWKSKLAKKLRSKGKQLLKDYANRVLNG
  • 3. L03A000026    From 1 To 37 E-value: 0.0000000002 Score: 55.8
        FRFGSFLKKVWKSKLAKKLRSKGKQLLKDYANKVLNG
  • 4. L12A08411|    From 11 To 50 E-value: 0.0000000004 Score: 55.1
        RFGGFFRRIWKSKLAKRLRSKGKELLKDYANRVINGGPEE
  • 5. L13A026921    From 1 To 36 E-value: 0.000000001 Score: 53.9
        FKFGSFIKRMWRSKLAKKLRAKGKELLRDYANRVLS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli ATCC 25922  MIC:  15.48 μg/ml  (3.09916 μM)  
  •   2  Target:  E. coli DH5a  MIC:  15.48 μg/ml  (3.09916 μM)  
  •   3  Target:  P. aeruginosa ATCC 257853  MIC:  31.47 μg/ml  (6.30043 μM)  
  •   4  Target:  K. pneumoniae ATCC 13833  MIC:  7.99 μg/ml  (1.59963 μM)  
  •   5  Target:  S. choleraesuis ATCC 13311  MIC:  15.48 μg/ml  (3.09916 μM)  
  •   6  Target:  H. influenzae ATCC 19418  MIC:  15.48 μg/ml  (3.09916 μM)  
  •   7  Target:  B. subtilis ATCC 6051  MIC:  31.47 μg/ml  (6.30043 μM)  
  •   8  Target:  L. monocytogenes NCTC 11994  MIC:  31.47 μg/ml  (6.30043 μM)  
  •   9  Target:  M. luteus ATCC 9341  MIC:  124.87 μg/ml  (24.9995 μM)  
  •   10  Target:  N. crassa  MIC:  12.49 μg/ml  (2.50055 μM)  
  •   11  Target:  B. cinerea  MIC:  17.48 μg/ml  (3.49957 μM)  
  •   12  Target:  F. culmorum  MIC:  1.5 μg/ml  (0.300306 μM)  
  •   13  Target:  S. cerevisiae  MIC:  9.99 μg/ml  (2.00004 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: