Record in detail


General Info

  • lamp_id:L01A000335
  • Name:seminalplasmin [Bos taurus]
  • FullName:seminalplasmin [Bos taurus]
  • Source:Bos taurus (cattle)
  • Mass:5539.2 Da
  • Sequence Length:48 aa
  • Isoelectric Point:11.08
  • Activity:Antibacterial, Antifungal
  • Sequence
        SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000196    From 33 To 80 E-value: 1e-23 Score: 100
        SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK
  • 2. L01A000335    From 1 To 48 E-value: 2e-23 Score: 99.4
        SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK
  • 3. L02A000234    From 1 To 47 E-value: 6e-23 Score: 97.8
        SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSV
  • 4. L01A000056    From 1 To 35 E-value: 0.000000000001 Score: 63.9
        SDEKASPDRHHRFSLSRYAKLANRL----------SKWIGNRGNR
  • 5. L13A022822    From 1 To 27 E-value: 0.0000000002 Score: 56.2
        SLSRYAKLANRLANPKLLETFLSKWIG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: