Record in detail


General Info

  • lamp_id:L01A000338
  • Name:Opistoporin-2
  • FullName:Opistoporin-2
  • Source:Opistophthalmus carinatus (African yellow leg scorpion)
  • Mass:4870.6 Da
  • Sequence Length:44 aa
  • Isoelectric Point:10.58
  • Activity:Antibacterial, Antifungal
  • Sequence
        GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08840|    From 23 To 66 E-value: 9e-20 Score: 87.4
        GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS
  • 2. L01A000338    From 1 To 44 E-value: 1e-19 Score: 87
        GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS
  • 3. L01A002450    From 1 To 44 E-value: 4e-19 Score: 85.1
        GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS
  • 4. L01A000337    From 1 To 44 E-value: 5e-19 Score: 84.7
        GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNLVAEKIGATPS
  • 5. L01A000318    From 1 To 44 E-value: 0.000000000000002 Score: 72.8
        GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: