Record in detail


General Info

  • lamp_id:L01A000349
  • Name:tracheal antimicrobial peptide [Bos taurus]
  • FullName:tracheal antimicrobial peptide [Bos taurus]
  • Source:Bos taurus (cattle)
  • Mass:4118 Da
  • Sequence Length:38 aa
  • Isoelectric Point:10.62
  • Activity:Antibacterial
  • Sequence
        NPVSCVRNKGICVPIRCPGNMKQIGTCVGRAVKCCRKK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000349    From 1 To 38 E-value: 5e-16 Score: 74.7
        NPVSCVRNKGICVPIRCPGNMKQIGTCVGRAVKCCRKK
  • 2. L01A001447    From 27 To 64 E-value: 6e-16 Score: 74.7
        NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK
  • 3. L01A000147    From 1 To 38 E-value: 0.000000000000001 Score: 73.6
        NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK
  • 4. L01A000483    From 1 To 36 E-value: 0.000000000000004 Score: 71.6
        NPVSCVRNKGICVPIRCPGNMKQIGTCVGRAVKCCR
  • 5. L12A09081|    From 27 To 64 E-value: 0.000000000000008 Score: 70.9
        NPLSCGRNKGICVPIRCPGKMKQIGTCVGRAVKCCRKK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: