Record in detail


General Info

  • lamp_id:L01A000354
  • Name:Dermaseptin-like precursor DRP-AC-3 [Agalychnis callidryas]
  • FullName:Dermaseptin-like precursor DRP-AC-3 [Agalychnis callidryas]
  • Source:Agalychnis callidryas (red-eyed leaf frog)
  • Mass:3001.4 Da
  • Sequence Length:30 aa
  • Isoelectric Point:6.51
  • Activity:Antimicrobial
  • Sequence
        SVLSTITDMAKAAGRAALNAITGLVNQGEQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000354    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        SVLSTITDMAKAAGRAALNAITGLVNQGEQ
  • 2. L12A06202|    From 46 To 75 E-value: 0.000000002 Score: 53.1
        SLLSTLGNMAKAAGRAALNAITGLVNQGEQ
  • 3. L02A000965    From 1 To 27 E-value: 0.000000002 Score: 53.1
        SVLSTITDMAKAAGRAALNAITGLVNQ
  • 4. L13A025501    From 1 To 27 E-value: 0.0000002 Score: 46.2
        SLLSTLGNMAKAAGRAALNAITGLVNQ
  • 5. L03A000087    From 46 To 75 E-value: 0.0000006 Score: 44.7
        SLWSKIKEMAATAGKAALNAVTGMVNQGEQ

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: