Record in detail


General Info

  • lamp_id:L01A000375
  • Name:Neutrophil defensin 3
  • FullName:Neutrophil defensin 3
  • Source:Homo sapiens (Human)
  • Mass:3492 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.11
  • Activity:Antibacterial, Antifungal, Antiviral,Anticancer
  • Sequence
        DCYCRIPACIAGERRYGTCIYQGRLWAFCC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09209|    From 65 To 94 E-value: 0.00000000000004 Score: 68.6
        DCYCRIPACIAGERRYGTCIYQGRLWAFCC
  • 2. L12A09208|    From 65 To 94 E-value: 0.00000000000004 Score: 68.6
        DCYCRIPACIAGERRYGTCIYQGRLWAFCC
  • 3. L12A09210|    From 66 To 94 E-value: 0.0000000000002 Score: 65.9
        CYCRIPACIAGERRYGTCIYQGRLWAFCC
  • 4. L03A000277    From 66 To 94 E-value: 0.0000000000002 Score: 65.9
        CYCRIPACIAGERRYGTCIYQGRLWAFCC
  • 5. L12A01084|    From 27 To 56 E-value: 0.0000000000002 Score: 65.9
        DCYCRIPACIAGERRYGTCIYQGRLWAFCC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: