Record in detail


General Info

  • lamp_id:L01A000395
  • Name:hematopoietic antimicrobial peptide-29
  • FullName:hematopoietic antimicrobial peptide-29
  • Source:Myxine glutinosa (Atlantic hagfish)
  • Mass:3296 Da
  • Sequence Length:30 aa
  • Isoelectric Point:11.89
  • Activity:Antimicrobial
  • Sequence
        GWFKKAWRKVKNAGRVLKGVGIHYGVGLIG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000395    From 1 To 30 E-value: 0.00000000003 Score: 58.9
        GWFKKAWRKVKNAGRVLKGVGIHYGVGLIG
  • 2. L01A002746    From 1 To 30 E-value: 0.000000002 Score: 52.8
        GWFKKAWRKVKNAGRRVLKGVGIHYGVGLI
  • 3. L02A000692    From 1 To 30 E-value: 0.000000002 Score: 52.8
        GWFKKAWRKVKNAGRRVLKGVGIHYGVGLI
  • 4. L01A001593    From 1 To 30 E-value: 0.0000001 Score: 47
        GXFKKAXRKVKNAGRRVLKGVGIHYGVGLI
  • 5. L12A04329|    From 1 To 28 E-value: 0.0002 Score: 36.2
        GWFKKAWRKVKHAGRRVLDTAKGVGRHY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: