Record in detail


General Info

  • lamp_id:L01A000397
  • Name:Cupiennin-1
  • FullName:Cupiennin-1
  • Source:Cupiennius salei
  • Mass:3799.6 Da
  • Sequence Length:35 aa
  • Isoelectric Point:11.05
  • Activity:Antibacterial
  • Sequence
        GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A02542|    From 1 To 35 E-value: 0.0000000000001 Score: 66.6
        GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME
  • 2. L01A000397    From 1 To 35 E-value: 0.0000000000001 Score: 66.6
        GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME
  • 3. L01A000398    From 1 To 35 E-value: 0.000000000001 Score: 63.9
        GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQME
  • 4. L01A000400    From 1 To 35 E-value: 0.000000000002 Score: 62.8
        GFGSLFKFLAKKVAKTVAKQAAKQGAKYVANKHME
  • 5. L01A000399    From 1 To 35 E-value: 0.000000000005 Score: 61.2
        GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQTE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli ATCC 25922  MIC:  0.31 μg/ml  (0.0815875 μM)  
  •   2  Target:  P. aeruginosa ATCC 27853  MIC:  0.31 μg/ml  (0.0815875 μM)  
  •   3  Target:  S. aureus ATCC 29213  MIC:  0.31 μg/ml  (0.0815875 μM)  
  •   4  Target:  E. faecalis ATCC 29212  MIC:  2.5 μg/ml  (0.657964 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: