Record in detail


General Info

  • lamp_id:L01A000406
  • Name:Neutrophil defensin 1
  • FullName:Neutrophil defensin 1
  • Source:Macaca mulatta (rhesus monkey)
  • Mass:3453.1 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.37
  • Activity:Antibacterial, Antifungal
  • Sequence
        ACYCRIPACLAGERRYGTCFYLGRVWAFCC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000288    From 67 To 96 E-value: 0.00000000000007 Score: 67.8
        ACYCRIPACLAGERRYGTCFYLGRVWAFCC
  • 2. L05A0DEF60    From 67 To 96 E-value: 0.00000000000007 Score: 67.8
        ACYCRIPACLAGERRYGTCFYLGRVWAFCC
  • 3. L12A09257|    From 67 To 96 E-value: 0.00000000000009 Score: 67.4
        ACYCRIPACLAGERRYGTCFYLGRVWAFCC
  • 4. L12A09256|    From 65 To 94 E-value: 0.00000000000009 Score: 67.4
        ACYCRIPACLAGERRYGTCFYLGRVWAFCC
  • 5. L12A09212|    From 67 To 96 E-value: 0.0000000000001 Score: 67
        ACYCRIPACLAGERRYGTCFYMGRVWAFCC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: