Record in detail


General Info

  • lamp_id:L01A000416
  • Name:DEF1_MESAU
  • FullName:Neutrophil defensin 1
  • Source:Mesocricetus auratus
  • Mass:4013.7 Da
  • Sequence Length:33 aa
  • Isoelectric Point:10.19
  • Activity:Antibacterial, Antifungal
  • Sequence
        VTCFCRRRGCASRERHIGYCRFGNTIYRLCCRR
  • Function:Anti-fungal and bactericidal activity, greater against Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000416    From 1 To 33 E-value: 0.0000000000003 Score: 65.5
        VTCFCRRRGCASRERHIGYCRFGNTIYRLCCRR
  • 2. L01A000417    From 1 To 33 E-value: 0.00000000001 Score: 60.1
        VTCFCRRRGCASRERLIGYCRFGNTIYGLCCRR
  • 3. L01A000418    From 1 To 33 E-value: 0.00000003 Score: 48.9
        VTCFCKRPVCDSGETQIGYCRLGNTFYRLCCRQ
  • 4. L01A000717    From 1 To 31 E-value: 0.0000004 Score: 45.1
        CFCKRPVCDSGETQIGYCRLGNTFYRLCCRQ
  • 5. L03A000065    From 61 To 92 E-value: 0.00001 Score: 40.4
        LVCYCRKRGCKGRERMNGTCRKGHLLYTMCCR

Structure

  •   Domains
  •   1  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   2  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dubin A.,Thogersen I.B.,Wojcik K.,Mak P.,
  •   Title:Isolation, antimicrobial activities, and primary structures of hamster neutrophil defensins.
  •   Journal:Infect. Immun., 1996, 64, 4444-4449  [MEDLINE:97045125]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: