Record in detail
General Info
- lamp_id:L01A000424
- Name:STYC_STYCL
- FullName:Styelin-C
- Source:Styela clava
- Mass:3500 Da
- Sequence Length:31 aa
- Isoelectric Point:10.91
- Activity:Antibacterial
- Sequence
GWFGKAFRSVSNFYKKHKTYIHAGLSAATLL - Function:Bactericidal against several Gram-positive and Gram-negative bacteria.
Cross-Linking
- Cross-linking
- 1 Database:APD 435
- 2 Database:CAMP CAMPSQ394
- 3 Database:dbAMP dbAMP_04328
- 4 Database:DRAMP DRAMP02594
- 5 Database:SATPdb satpdb11145
- 6 Database:Uniprot O18494
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000424 From 1 To 31 E-value: 0.0000000000006 Score: 64.7
GWFGKAFRSVSNFYKKHKTYIHAGLSAATLL - 2. L13A025018 From 1 To 30 E-value: 0.000000000002 Score: 62.8
GWFGKAFRSVSNFYKKHKTYIHAGLSAATL - 3. L03A000053 From 1 To 30 E-value: 0.00000000005 Score: 58.2
GWFGKAFRSVSNFYKKH-TYIHAGLSAATLL - 4. L01A000425 From 1 To 19 E-value: 0.002 Score: 33.1
GXFGKAFXSVSNFAKKHKT - 5. L03A000054 From 1 To 19 E-value: 0.004 Score: 32
GXFGPAFHSVSNFAKKHKT
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Lehrer R.I.,Lee I.H.,Liaw L.,Zhao C.,
- Title:cDNA cloning of three cecropin-like antimicrobial peptides (Styelins) from the tunicate, Styela clava.
- Journal:FEBS Lett., 1997, 412, 144-148 [MEDLINE:97400214]
Comments
- Comments
No comments found on LAMP database