Record in detail


General Info

  • lamp_id:L01A000451
  • Name:DDSK_PHYDS
  • FullName:Dermadistinctin-K
  • Source:Phyllomedusa distincta
  • Mass:3152.6 Da
  • Sequence Length:33 aa
  • Isoelectric Point:10.8
  • Activity:Antibacterial
  • Sequence
        GLWSKIKAAGKEAAKAAAKAAGKAALNAVSEAV
  • Function:Has antibacterial activity against the Gram-positive bacteria S.aureus and E.faecalis, and the Gram-negative bacteria P.aeruginosa and E.coli. Has antiprotozoal activity against T.cruzi. Has antifungal activity against the yeasts C.tropicalis (MIC=10.1 uM), C.guilliermondii (MIC=20.3 uM), C.albicans (MIC=20.3 uM) and C.albicans ATCC 1023 (MIC=10.1 uM). Decreases viability of murine peritoneal cells. Fuses to, and disrupts liposomes.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A03839|    From 1 To 33 E-value: 0.0000000002 Score: 55.8
        GLWSKIKAAGKEAAKAAAKAAGKAALNAVSEAV
  • 2. L01A000451    From 1 To 33 E-value: 0.0000000002 Score: 55.8
        GLWSKIKAAGKEAAKAAAKAAGKAALNAVSEAV
  • 3. L02A000937    From 1 To 29 E-value: 0.0003 Score: 35.4
        GLWSKI----KEAGKAVLTAAGKAALGAVSDAV
  • 4. L03A000083    From 46 To 77 E-value: 0.002 Score: 33.5
        GMWSTIRNVGKSAAKAANLPA-KAALGAISEAV
  • 5. L01A002844    From 1 To 32 E-value: 0.002 Score: 33.1
        GMWSTIRNVGKSAAKAANLPA-KAALGAISEAV

Structure

  •   Domains
  •   1  Name:Dermaseptin    Interpro Link:IPR022731
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  MIC:  1.89156 μg/ml  (0.6 μM)  
  •   2  Target:  S. aureus  MIC:  14.8172 μg/ml  (4.7 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ferrara L.,Scaloni A.,Sebben A.,da Silva L.R.,Batista C.V.F.,
  •   Title:Antimicrobial peptides from the Brazilian frog Phyllomedusa distincta.
  •   Journal:Peptides, 1999, 20, 679-686  [MEDLINE:99404773]
  •   [2]  Prates M.V.,Albuquerque S.,Silva L.P.,Leite J.R.S.A.,Brand G.D.,
  •   Title:Dermaseptins from Phyllomedusa oreades and Phyllomedusa distincta. Anti-Trypanosoma cruzi activity without cytotoxicity to mammalian cells.
  •   Journal:J. Biol. Chem., 2002, 277, 49332-49340  [MEDLINE:22370988]
  •   [3]  Tedesco A.C.,Regis W.B.,Brand G.D.,Leite J.R.S.A.,Silva L.P.,
  •   Title:Dermaseptins from Phyllomedusa oreades and Phyllomedusa distincta: liposomes fusion and/or lysis investigated by fluorescence and atomic force microscopy.
  •   Journal:Comp. Biochem. Physiol., 2008, 151, 329-335  [PubMed:17409003]
  •   [4]  Bento W.R.C.,Kuckelhaus S.A.S.,Silva L.P.,Brand G.D.,Leite J.R.S.A.,
  •   Title:Dermaseptins from Phyllomedusa oreades and Phyllomedusa distincta: Secondary structure, antimicrobial activity, and mammalian cell toxicity.
  •   Journal:Comp. Biochem. Physiol., 2008, 151, 336-343  [PubMed:17442605]
  •   [5]  Bemquerer M.P.,Aisenbrey C.,Resende J.M.,de Moraes C.M.,Verly R.M.,
  •   Title:Structure and membrane interactions of the antibiotic peptide dermadistinctin K by multidimensional solution and oriented 15N and 31P solid-state NMR spectroscopy.
  •   Journal:Biophys. J., 2009, 96, 2194-2203  [PubMed:19289046]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: