Record in detail


General Info

  • lamp_id:L01A000498
  • Name:DMS2_PHYSA
  • FullName:Dermaseptin-2
  • Source:Phyllomedusa sauvagei
  • Mass:3473.1 Da
  • Sequence Length:34 aa
  • Isoelectric Point:11.1
  • Activity:Antibacterial, Antifungal
  • Sequence
        ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ
  • Function:Possesses a potent antimicrobial activity against bacteria, fungi and protozoa. Probably acts by disturbing membrane functions with its amphipathic structure.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000498    From 1 To 34 E-value: 0.0000000000002 Score: 66.6
        ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ
  • 2. L12A06611|    From 45 To 78 E-value: 0.0000000008 Score: 54.3
        AMWKDVLKKIGTVALHAGKAALGAVADTISQGEQ
  • 3. L12A06182|    From 45 To 78 E-value: 0.000000001 Score: 53.9
        AMWKDVLKKIGTVALHAGKAALGAVADTISQGEQ
  • 4. L11A012112    From 1 To 31 E-value: 0.000000002 Score: 52.8
        ALWKTMLKKLGTVALHAGKAALGAVADTISQ
  • 5. L02A000956    From 1 To 31 E-value: 0.00000003 Score: 49.3
        ALWKDVLKKIGTVALHAGKAALGAVADTISQ

Structure

  •   Domains
  •   1  Name:Dermaseptin    Interpro Link:IPR022731
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  MIC:  8.68275 μg/ml  (2.5 μM)  
  •   2  Target:  S. aureus  MIC:  69.462 μg/ml  (20 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Nicolas P.,Mor A.,
  •   Title:Isolation and structure of novel defensive peptides from frog skin.
  •   Journal:Eur. J. Biochem., 1994, 219, 145-154  [MEDLINE:94139686]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: