Record in detail

lamp_id:L01A000499
Name:DMS3_PHYSA
FullName:Dermaseptin-3
Source:Phyllomedusa sauvagei
Mass:3023.7 Da
Sequence Length:30 aa
Isoelectric Point:11.1
Activity:Antifungal, Antiviral
Sequence
ALWKNMLKGIGKLAGKAALGAVKKLVGAES
Function:Possesses a potent antimicrobial activity against bacteria, fungi and protozoa. Probably acts by disturbing membrane functions with its amphipathic structure. Binds to healthy erythrocytes (this binding is receptor independent), but has very weak hemolytic activity. Does not bind to P.falciparum infected erythrocytes, but accumulates within the parasite. Kills the parasite, but has no hemolytic activity on the host cell.

Top similar AMPs on LAMP
1. L01A000499 From 1 To 30 E-value: 0.0000000004 Score: 55.1
ALWKNMLKGIGKLAGKAALGAVKKLVGAES
2. L01A000454 From 1 To 30 E-value: 0.000000002 Score: 53.1
ALWKNMLKGIGKLAGQAALGAVKTLVGAES
3. L12A06201| From 46 To 74 E-value: 0.000000003 Score: 52.4
ALWKNMLKGIGKLAGQAALGAVKTLVGAE
4. L02A000165 From 1 To 29 E-value: 0.000000006 Score: 51.2
ALWKNMLKGIGKLAGQAALGAVKTLVGAE
5. L01A000151 From 1 To 28 E-value: 0.00000003 Score: 48.9
ALWKNMLKGIGKLAGQAALGAVKTLVGA

Antibacterial Activities
1 Target: A. fumigatus Malarial parasite strain H IC50: 2.42 μg/ml (0.800344 μM)
2 Target: Malarial parasite strain NF54 IC50: 0.79 μg/ml (0.261269 μM)
3 Target: E. coli MIC: 2.41896 μg/ml (0.8 μM)
4 Target: S. aureus MIC: 30.237 μg/ml (10 μM)

Reference
[1] Nicolas P.,Mor A.,
Title:Isolation and structure of novel defensive peptides from frog skin.
Journal:Eur. J. Biochem., 1994, 219, 145-154 [MEDLINE:94139686]
[2] Mazier D.,Ciceron L.,Guillaud P.,Shaool D.,Ghosh J.K.,
Title:Selective cytotoxicity of dermaseptin S3 toward intraerythrocytic Plasmodium falciparum and the underlying molecular basis.
Journal:J. Biol. Chem., 1997, 272, 31609-31616 [PubMed:9395500]