Record in detail


General Info

  • lamp_id:L01A000501
  • Name:DMS5_PHYSA
  • FullName:Dermaseptin-5
  • Source:Phyllomedusa sauvagei
  • Mass:2840.4 Da
  • Sequence Length:29 aa
  • Isoelectric Point:11.5
  • Activity:Antifungal
  • Sequence
        GLWSKIKTAGKSVAKAAAKAAVKAVTNAV
  • Function:Possesses a potent antimicrobial activity against bacteria, fungi and protozoa. Probably acts by disturbing membrane functions with its amphipathic structure.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000501    From 1 To 29 E-value: 0.000000006 Score: 51.2
        GLWSKIKTAGKSVAKAAAKAAVKAVTNAV
  • 2. L02A000937    From 1 To 29 E-value: 0.0001 Score: 37
        GLWSKIKEAGKAVLTAAGKAALGAVSDAV
  • 3. L03A000083    From 46 To 77 E-value: 0.01 Score: 30.8
        GMWSTIRNVGKSAAKAANLPAKAALGAISEAV
  • 4. L01A002844    From 1 To 32 E-value: 0.014 Score: 30
        GMWSTIRNVGKSAAKAANLPAKAALGAISEAV
  • 5. L12A06610|    From 46 To 71 E-value: 0.13 Score: 26.9
        GLW---KSLLKNVGKAAGKAALNAVTDMV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  MIC:  99.414 μg/ml  (35 μM)  
  •   2  Target:  S. aureus  MIC:  5.6808 μg/ml  (2 μM)  

Toxicity

  •   Toxicity

Reference

  •   Reference
  •   [1]  Nicolas P.,Mor A.,
  •   Title:Isolation and structure of novel defensive peptides from frog skin.
  •   Journal:Eur. J. Biochem., 1994, 219, 145-154  [MEDLINE:94139686]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: