Record in detail


General Info

  • lamp_id:L01A000503
  • Name:LCCA_LEUGE
  • FullName:Bacteriocin leucocin-A
  • Source:Leuconostoc gelidum
  • Mass:3932.3 Da
  • Sequence Length:37 aa
  • Isoelectric Point:8.77
  • Activity:Antibacterial
  • Sequence
        KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW
  • Function:Inhibits a wide spectrum of lactic acid bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08493|    From 25 To 61 E-value: 2e-17 Score: 79.3
        KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW
  • 2. L12A08826|    From 25 To 61 E-value: 2e-17 Score: 79.3
        KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW
  • 3. L01A000503    From 1 To 37 E-value: 1e-16 Score: 77
        KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW
  • 4. L12A09479|    From 25 To 61 E-value: 2e-16 Score: 76.3
        KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW
  • 5. L01A003118    From 1 To 37 E-value: 9e-16 Score: 73.9
        KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW

Structure

  •   Domains
  •   1  Name:Bacteriocin_IIa    Interpro Link:IPR002633
  •   2  Name:Bacteriocin_IIa_CS    Interpro Link:IPR023384
  •   3  Name:Bacteriocin_IIa_dom    Interpro Link:IPR023388
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Vederas J.C.,Roy K.L.,Johnson K.,Sailer M.,Hastings J.W.,
  •   Title:Characterization of leucocin A-UAL 187 and cloning of the bacteriocin gene from Leuconostoc gelidum.
  •   Journal:J. Bacteriol., 1991, 173, 7491-7500  [MEDLINE:92041660]
  •   [2]  Stiles M.E.,Niemczura W.P.,Henkel T.,Helms G.L.,Sailer M.,
  •   Title:15N- and 13C-labeled media from Anabaena sp. for universal isotopic labeling of bacteriocins: NMR resonance assignments of leucocin A from Leuconostoc gelidum and nisin A from Lactococcus lactis.
  •   Journal:Biochemistry, 1993, 32, 310-318  [MEDLINE:93120109]
  •   [3]  Stiles M.E.,Nakashima T.T.,Niemczura W.P.,Sailer M.,Gallagher N.L.F.,
  •   Title:Three-dimensional structure of leucocin A in trifluoroethanol and dodecylphosphocholine micelles: spatial location of residues critical for biological activity in type IIa bacteriocins from lactic acid bacteria.
  •   Journal:Biochemistry, 1997, 36, 15062-15072  [MEDLINE:98060758]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: