Record in detail


General Info

  • lamp_id:L01A000505
  • Name:DEFA_AEDAE
  • FullName:Defensin-A
  • Source:Aedes aegypti
  • Mass:4078.6 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.39
  • Activity:Antibacterial
  • Sequence
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCRN
  • Function:Antibacterial peptide mostly active against Gram-positive bacteria. Has activity against the bacteria Gram-negative E.cloacae beta12.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000168    From 59 To 98 E-value: 5e-19 Score: 84.7
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCRN
  • 2. L01A000505    From 1 To 40 E-value: 7e-18 Score: 80.9
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCRN
  • 3. L03A000348    From 57 To 94 E-value: 9e-18 Score: 80.5
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVC
  • 4. L12A09253|    From 60 To 99 E-value: 1e-17 Score: 80.1
        ATCDLLSGFGVGDSACAAHCIARRNRGGYCNAKKVCVCRN
  • 5. L01A002933    From 1 To 40 E-value: 1e-17 Score: 80.1
        ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCRN

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E.cloacae beta12  MIC:  4.89 μg/ml  (1.19894 μM)  
  •   2  Target:  Aerococcus viridans  MIC:  2.45 μg/ml  (0.600696 μM)  
  •   3  Target:  Micrococcus luteus  MIC:  2.45 μg/ml  (0.600696 μM)  
  •   4  Target:  Bacillus rnegaterium  MIC:  2.45 μg/ml  (0.600696 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Townson H.,Ham P.J.,Albuquerque C.M.,Chalk R.,
  •   Title:Full sequence and characterization of two insect defensins: immune peptides from the mosquito Aedes aegypti.
  •   Journal:Proc. R. Soc. B, 1995, 261, 217-221  [MEDLINE:96047965]
  •   [2]  Hodgeman B.,Hetru C.,Charlet M.,Bulet P.,Lowenberger C.,
  •   Title:Insect immunity: isolation of three novel inducible antibacterial defensins from the vector mosquito, Aedes aegypti.
  •   Journal:Insect Biochem. Mol. Biol., 1995, 25, 867-873  [MEDLINE:95360030]
  •   [3]  Ho C.-M.,Chen C.-C.,Fu Y.-C.,Cho W.-L.,
  •   Title:Cloning and characterization of cDNAs encoding the antibacterial peptide, defensin A, from the mosquito, Aedes aegypti.
  •   Journal:Insect Biochem. Mol. Biol., 1996, 26, 395-402  [MEDLINE:96245441]
  •   [4]  Fallon A.M.,Hernandez V.P.,Gao Y.,
  •   Title:Immunity proteins from mosquito cell lines include three defensin A isoforms from Aedes aegypti and a defensin D from Aedes albopictus.
  •   Journal:Insect Mol. Biol., 1999, 8, 311-318  [MEDLINE:99398196]
  •   [5]  Severson D.W.,Ferdig M.T.,Bulet P.,Smartt C.T.,Lowenberger C.A.,
  •   Title:Insect immunity: molecular cloning, expression, and characterization of cDNAs and genomic DNA encoding three isoforms of insect defensin in Aedes aegypti.
  •   Journal:Insect Mol. Biol., 1999, 8, 107-118  [MEDLINE:99124369]
  •   [6]  Eggleston P.,Hurd H.,Grail W.,Munks R.J.,Meredith J.M.,
  •   Title:A novel association between clustered NF-kappaB and C/EBP binding sites is required for immune regulation of mosquito Defensin genes.
  •   Journal:Insect Mol. Biol., 2006, 15, 393-401  [PubMed:16907826]
  •   [7]  Kodira C.D.,Haas B.J.,Lawson D.,Wortman J.R.,Nene V.,
  •   Title:Genome sequence of Aedes aegypti, a major arbovirus vector.
  •   Journal:Science, 2007, 316, 1718-1723  [PubMed:17510324]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: