Record in detail
General Info
- lamp_id:L01A000507
- Name:CECB1_CULPP
- FullName:Cecropin-B1
- Source:Culex pipiens pipiens
- Mass:3574.4 Da
- Sequence Length:34 aa
- Isoelectric Point:11.97
- Activity:Antibacterial
- Sequence
GRLKKLGKKIEKAGKRVFNAVQKGLPVAAGVQAL - Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ474
- 2 Database:dbAMP dbAMP_04004
- 3 Database:DRAMP DRAMP03128
- 4 Database:Uniprot Q86PR5
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000507 From 1 To 34 E-value: 0.0000000000007 Score: 64.3
GRLKKLGKKIEKAGKRVFNAVQKGLPVAAGVQAL - 2. L13A014730 From 1 To 33 E-value: 0.000000000002 Score: 62.8
GRLKKLGKKIEKAGKRVFNAVQKGLPVAAGVQA - 3. L01A000506 From 1 To 34 E-value: 0.000000000009 Score: 60.8
GRSKKLGKKIEKAGKRVFNAAQKGLPVAAGVQAL - 4. L13A013617 From 1 To 33 E-value: 0.00000000003 Score: 59.3
GRSKKLGKKIEKAGKRVFNAAQKGLPVAAGVQA - 5. L12A08722| From 24 To 57 E-value: 0.00000000005 Score: 58.2
GRLKKLGKKIERAGKRVFNAAQKGLPVAAGIKGL
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database