Record in detail

lamp_id:L01A000509
Name:AMYL_LACAM
FullName:Bacteriocin amylovorin-L
Source:Lactobacillus amylovorus
Mass:4881.7 Da
Sequence Length:50 aa
Isoelectric Point:10.37
Activity:Antibacterial
Sequence
NRWTNAYSAALGCAVPGVKYGKKLGGVWGAVIGGVGGAAVCGLAGYVRKG
Function:This heat stable bacteriocin inhibits the growth of closely related Lactobacillus species. It may act as a pore-forming protein, creating a channel in the cell membrane. It kills Lactobacillus helveticus ATCC 15009, but displays no activity towards Listeria species.

Top similar AMPs on LAMP
1. L12A08193| From 16 To 65 E-value: 3e-22 Score: 95.5
NRWTNAYSAALGCAVPGVKYGKKLGGVWGAVIGGVGGAAVCGLAGYVRKG
2. L01A000509 From 1 To 50 E-value: 8e-22 Score: 94
NRWTNAYSAALGCAVPGVKYGKKLGGVWGAVIGGVGGAAVCGLAGYVRKG
3. L12A08084| From 15 To 62 E-value: 0.015 Score: 30
NRWGDTVLSAASGAGTGIKACKSFG-PWGMAICGVGGAAIGGYFGYTHN
4. L02A001169 From 1 To 48 E-value: 0.016 Score: 30
NRWGDTVLSAASGAGTGIKACKSFG-PWGMAICGVGGAAIGGYFGYTHN
5. L12A08876| From 27 To 64 E-value: 0.03 Score: 28.9
AALGCAAGGVKYGRLL-GLWGAAIGGIGGAVVCGYLAYT

Reference
[1] Raymaeckers J.,Busanyova K.,Devreese B.,De Vuyst L.,Contreras B.G.L.,
Title:Isolation, purification, and amino acid sequence of lactobin A, one of the two bacteriocins produced by Lactobacillus amylovorus LMG P-13139.
Journal:Appl. Environ. Microbiol., 1997, 63, 13-20 [MEDLINE:97133940]
[2] Nes I.,Van Beeumen J.,Devreese B.,Holo H.,Callewaert R.,
Title:Characterization and production of amylovorin L471, a bacteriocin purified from Lactobacillus amylovorus DCE 471 by a novel three-step method.
Journal:Microbiology, 1999, 145, 2559-2568 [PubMed:10517609]
[3] Vancanneyt M.,Hoste B.,Neysens P.,Avonts L.,De Vuyst L.,
Title:The lactobin A and amylovorin L471 encoding genes are identical, and their distribution seems to be restricted to the species Lactobacillus amylovorus that is of interest for cereal fermentations.
Journal:Int. J. Food Microbiol., 2004, 90, 93-106 [PubMed:14672834]