Record in detail


General Info

  • lamp_id:L01A000511
  • Name:PFPA_ENTHI
  • FullName:Pore-forming peptide ameobapore A
  • Source:Entamoeba histolytica
  • Mass:8244.6 Da
  • Sequence Length:77 aa
  • Isoelectric Point:5.74
  • Activity:Antibacterial
  • Sequence
        GEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC
  • Function:Forms pores in the cytoplasmic membrane of host cells. Has antibacterial activity against M.luteus, no activity against E.coli. Implicated in the cytolytic activity of the parasite.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000125    From 22 To 98 E-value: 2e-39 Score: 152
        GEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC
  • 2. L01A000511    From 1 To 77 E-value: 6e-39 Score: 150
        GEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC
  • 3. L03A000126    From 21 To 97 E-value: 8e-38 Score: 147
        GPIVCNLCTGLINTLENLLTTKGADKVKDYIDSLCNKASGFIATLCTKVLDFGVDKLIQLIEDKVDANAICAKIHAC
  • 4. L13A027526    From 1 To 50 E-value: 5e-23 Score: 98.2
        GEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVL
  • 5. L03A000240    From 20 To 96 E-value: 7e-23 Score: 97.8
        GSILCNLCKDTVNLIENLLTVDGAQAVRQYIDNLCAKADGFLGTLCNKILSFGVDELVKLIENHVDPVVICEKIHAC

Structure

  •   Domains
  •   1  Name:SapB_1    Interpro Link:IPR007856
  •   2  Name:SapB_2    Interpro Link:IPR008138
  •   3  Name:Saposin-like    Interpro Link:IPR011001
  •   4  Name:SaposinB    Interpro Link:IPR008139
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  M.luteus  MIC:  15.66 μg/ml  (1.89943 μM)  
  •   2  Target:  B. megaterium  MIC:  107.18 μg/ml  (13 μM)  
  •   3  Target:  B. subtilis  MIC:  222.6 μg/ml  (26.9995 μM)  
  •   4  Target:  S.aureus  MIC:  123.67 μg/ml  (15.0001 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Mueller-Eberhard H.J.,Horstmann R.D.,Schoenberger O.L.,Ebel S.,Leippe M.,
  •   Title:Pore-forming peptide of pathogenic Entamoeba histolytica.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1991, 88, 7659-7663  [MEDLINE:91352048]
  •   [2]  Pattus F.,van der Goot G.,Nickel R.,Tannich E.,Leippe M.,
  •   Title:Primary and secondary structure of the pore-forming peptide of pathogenic Entamoeba histolytica.
  •   Journal:EMBO J., 1992, 11, 3501-3506  [MEDLINE:93010939]
  •   [3]  Tannich E.,Lioutas C.,Leippe M.,Bruchhaus I.,
  •   Title:Unusual gene organization in the protozoan parasite Entamoeba histolytica.
  •   Journal:DNA Cell Biol., 1993, 12, 925-933  [MEDLINE:94099892]
  •   [4]  Mueller-Eberhard H.J.,Tannich E.,Nickel R.,Andrae J.,Leippe M.,
  •   Title:Amoebapores, a family of membranolytic peptides from cytoplasmic granules of Entamoeba histolytica: isolation, primary structure, and pore formation in bacterial cytoplasmic membranes.
  •   Journal:Mol. Microbiol., 1994, 14, 895-904  [MEDLINE:95231296]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: