Record in detail


General Info

  • lamp_id:L01A000518
  • Name:homologueof proline/arginine rich antibacterial peptides
  • FullName:homologueof proline/arginine rich antibacterial peptides
  • Source:Sus scrofa (pig)
  • Mass:11537.5 Da
  • Sequence Length:99 aa
  • Isoelectric Point:13.65
  • Activity:Antibacterial
  • Sequence
        RRFPWWWPFLRRPRLRRQAFPPPNVPGPRFPPPNVPGPRFPPPNFPGPRFPPPNFPGPRFPPPNFPPPFPPPIFPGPWFPPPPPFRPPPFGPPRFPGRR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000518    From 1 To 99 E-value: 2e-38 Score: 149
        RRFPWWWPFLRRPRLRRQAFPPPNVPGPRFPPPNVPGPRFPPPNFPGPRFPPPNFPGPRFPPPNFPPPFPPPIFPGPWFPPPPPFRPPPFGPPRFPGRR
  • 2. L13A013494    From 1 To 48 E-value: 0.000000000000002 Score: 72.8
        AFPPPNVPGPRFPPPNVPGPRFPPPNFPGPRFPPPNFPGPRFPPPNFP
  • 3. L13A013494    From 1 To 50 E-value: 0.00000000002 Score: 60.1
        AFPPPNVPGPRFPPPNVPGPRFPPPNFPGPRFPPPNFPGPRFPPPNFPGP
  • 4. L13A013494    From 12 To 50 E-value: 0.00000000008 Score: 57.4
        FPPPNVPGPRFPPPNFPGPRFPPPNFPGPRFPPPNFPGP
  • 5. L13A013494    From 1 To 35 E-value: 0.0003 Score: 35.8
        AFPPPNVPGPRFPPPNVPGPRFPPP---------NFPGPRFPPP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: