Record in detail


General Info

  • lamp_id:L01A000524
  • Name:GLL8_CHICK
  • FullName:Gallinacin-8
  • Source:Gallus gallus
  • Mass:4593.1 Da
  • Sequence Length:41 aa
  • Isoelectric Point:7.37
  • Activity:Antibacterial
  • Sequence
        NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCCRTVYD
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF297    From 26 To 66 E-value: 5e-21 Score: 91.3
        NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCCRTVYD
  • 2. L01A000524    From 1 To 41 E-value: 5e-20 Score: 88.2
        NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCCRTVYD
  • 3. L11A003171    From 1 To 41 E-value: 1e-18 Score: 83.2
        NNEAQCEQAGGDCSKDHCFHLHTRAFGHCQRGVPCCRDVYD
  • 4. L11A003168    From 1 To 41 E-value: 1e-18 Score: 83.2
        NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGRPCCRTRYD
  • 5. L11A003169    From 1 To 41 E-value: 2e-18 Score: 83.2
        NNEAQCEQAGGRCSKDHCFHLHTRAFGHCQRGVPCCRRVYD

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Cheng J.-F.,Matsuda Y.,Ando J.,Hughes A.L.,Xiao Y.,
  •   Title:A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.
  •   Journal:BMC Genomics, 2004, 5, 56-56  [PubMed:15310403]
  •   [2]  Tierney J.,McMahon J.,Gaines S.,Lynn D.J.,Higgs R.,
  •   Title:The synthetic form of a novel chicken beta-defensin identified in silico is predominantly active against intestinal pathogens.
  •   Journal:Immunogenetics, 2005, 57, 90-98  [PubMed:15744537]
  •   [3]  Yoshimura Y.,Nishibori M.,Isobe N.,Subedi K.,
  •   Title:Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).
  •   Journal:Reproduction, 2007, 133, 127-133  [PubMed:17244739]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: