Record in detail


General Info

  • lamp_id:L01A000525
  • Name:STYD_STYCL
  • FullName:Styelin-D
  • Source:Styela clava
  • Mass:3811.5 Da
  • Sequence Length:32 aa
  • Isoelectric Point:10.83
  • Activity:Antibacterial, Antifungal
  • Sequence
        GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL
  • Function:Bactericidal against several Gram-positive and Gram-negative bacteria. Plays a significant role in the innate immune mechanisms of S.clava.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08954|    From 23 To 54 E-value: 0.00000000000004 Score: 68.6
        GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL
  • 2. L01A000525    From 1 To 32 E-value: 0.000000000001 Score: 63.9
        GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL
  • 3. L13A025503    From 1 To 31 E-value: 0.000000000004 Score: 62
        GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHA
  • 4. L02A000331    From 1 To 32 E-value: 0.000000000005 Score: 61.6
        GWLRKAAKSVGKFYYKHKYYIKAAWKIGRHAL
  • 5. L01A003107    From 1 To 32 E-value: 0.000000000006 Score: 61.2
        GWLRKAAKSVGKFYYKHKYYIKAAWKIGRHAL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lehrer R.I.,Lee I.H.,Liaw L.,Zhao C.,
  •   Title:cDNA cloning of three cecropin-like antimicrobial peptides (Styelins) from the tunicate, Styela clava.
  •   Journal:FEBS Lett., 1997, 412, 144-148  [MEDLINE:97400214]
  •   [2]  Lehrer R.I.,Park M.,Fischer W.H.,Craig A.G.,Taylor S.W.,
  •   Title:Styelin D, an extensively modified antimicrobial peptide from ascidian hemocytes.
  •   Journal:J. Biol. Chem., 2000, 275, 38417-38426  [MEDLINE:20556280]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: