Record in detail


General Info

  • lamp_id:L01A000532
  • Name:MYR4_MYRBA
  • FullName:Pilosulin-4
  • Source:Myrmecia banksi
  • Mass:4087 Da
  • Sequence Length:36 aa
  • Isoelectric Point:10.63
  • Activity:Antibacterial
  • Sequence
        FDITKLNIKKLTKATCKVISKGASMCKVLFDKKKQE
  • Function:Shows activity against E.coli and S.aureus (MIC<6.25uM), moderate activity against P.aeruginosa (MIC<25uM), weak activity against B.subtilis (MIC<50uM), and has no effect against L.garvieae, C.albicans, and S.cerevisiae. Has no hemolytic nor cytolytic activity. Causes an IgE-independent histamine release.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08089|    From 49 To 84 E-value: 0.000000000000004 Score: 71.6
        FDITKLNIKKLTKATCKVISKGASMCKVLFDKKKQE
  • 2. L01A000532    From 1 To 36 E-value: 0.00000000000001 Score: 70.5
        FDITKLNIKKLTKATCKVISKGASMCKVLFDKKKQE
  • 3. L02A000892    From 2 To 36 E-value: 0.00000000000006 Score: 68.2
        DITKLNIKKLTKATCKVISKGASMCKVLFDKKKQE
  • 4. L02A000890    From 2 To 26 E-value: 6.2 Score: 21.2
        DWKKVDWKKVSKKTCKVMLKA---CKFL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kubo T.,Taylor R.W.,Imai H.T.,Akagi M.,Inagaki H.,
  •   Title:Molecular cloning and biological characterization of novel antimicrobial peptides, pilosulin 3 and pilosulin 4, from a species of the Australian ant genus Myrmecia.
  •   Journal:Arch. Biochem. Biophys., 2004, 428, 170-178  [PubMed:15246874]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: