Record in detail


General Info

  • lamp_id:L01A000569
  • Name:PA3A_RANPA
  • FullName:Palustrin-3a
  • Source:Rana palustris
  • Mass:4933.9 Da
  • Sequence Length:48 aa
  • Isoelectric Point:10.06
  • Activity:Antibacterial
  • Sequence
        GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC
  • Function:Antimicrobial activity against Gram-negative bacterium E.coli.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07029|    From 39 To 86 E-value: 8e-22 Score: 94
        GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC
  • 2. L01A000569    From 1 To 48 E-value: 5e-21 Score: 91.3
        GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC
  • 3. L12A07028|    From 39 To 86 E-value: 1e-20 Score: 90.1
        GIFPKIIGKGIKTGIVNGIKNLVKGVGMKVFKAGLSNIGNTGCNEDEC
  • 4. L01A000559    From 1 To 48 E-value: 1e-20 Score: 90.1
        GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLSNIGNTGCNEDEC
  • 5. L02A001271    From 1 To 45 E-value: 0.000000000000004 Score: 71.6
        GIFPKIIGKGI----VNGIKSLAKGVGMKVFKAGLNNIGNTGCNNRDEC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E.coli  MIC:  4.93 μg/ml  (0.99921 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Conlon J.M.,Dulka J.,Knoop F.C.,Basir Y.J.,
  •   Title:Multiple antimicrobial peptides and peptides related to bradykinin and neuromedin N isolated from skin secretions of the pickerel frog, Rana palustris.
  •   Journal:Biochim. Biophys. Acta, 2000, 1543, 95-105  [PubMed:11087945]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: