Record in detail


General Info

  • lamp_id:L01A000575
  • Name:DEFI_PYRAP
  • FullName:Defensin
  • Source:Pyrrhocoris apterus
  • Mass:4734.5 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.63
  • Activity:Antibacterial
  • Sequence
        ATCDILSFQSQWVTPNHAGCALHCVIKGYKGGQCKITVCHCRR
  • Function:Antibacterial peptide. Affects Gram-positive bacteria M.luteus, B.megaterium, A.viridans, S.aureus and S.saprophyticus. Moderate activity against P.acidilactici and B.subtilis QB935. Also affects Gram-negative bacterium, D22 form of E.coli.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000575    From 1 To 43 E-value: 4e-21 Score: 91.7
        ATCDILSFQSQWVTPNHAGCALHCVIKGYKGGQCKITVCHCRR
  • 2. L05ADEF450    From 1 To 43 E-value: 0.000000000000001 Score: 73.6
        ATCDLFSFQSQWVTPNHAACAAHCLLRGNRGGECKGTICHCRK
  • 3. L05ADEF451    From 1 To 43 E-value: 0.000000000000002 Score: 73.2
        ATCDLFSFQSKWVTPNHAACAAHCLLRGNRGGQCKGTICHCRK
  • 4. L02A001369    From 1 To 43 E-value: 0.000000000000002 Score: 73.2
        ATCDLLSFRSKWVTPNHAGCAAHCLLRGNRGGHCKGTICHCRK
  • 5. L05ADEF444    From 1 To 43 E-value: 0.000000000000002 Score: 72.8
        ATCDLLSFSSKWVTPNHAGCAAHCLLRGNRGGHCKGTICHCRK

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Holder F.,Lanot R.,Hegy G.,Dupont A.,Cociancich S.,
  •   Title:Novel inducible antibacterial peptides from a hemipteran insect, the sap-sucking bug Pyrrhocoris apterus.
  •   Journal:Biochem. J., 1994, 300, 567-575  [MEDLINE:94271176]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: