Record in detail

lamp_id:L01A000576
Name:DMS2_PHYBI
FullName:Adenoregulin
Source:Phyllomedusa bicolor
Mass:3181.7 Da
Sequence Length:33 aa
Isoelectric Point:10.5
Activity:Antibacterial, Antifungal,Anticancer
Sequence
GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV
Function:Enhances binding of agonists to adenosine A1 receptors, adenosine A2a receptors, alpha-2 adrenergic receptors and 5-hydroxytryptamine 1A receptors. Enhances guanyl nucleotide exchange which may result in the conversion of receptors to a high affinity state complexed with guanyl nucleotide free G-protein. Affects human behavior eliciting profound malaise, followed by listlessness and then euphoria. Possesses a potent antimicrobial activity against bacteria, fungi and protozoa. Lacks hemolytic activity. Probably acts by disturbing membrane functions with its amphipathic structure.

Top similar AMPs on LAMP
1. L12A06181| From 46 To 78 E-value: 0.00000000003 Score: 58.9
GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV
2. L01A000576 From 1 To 33 E-value: 0.0000000001 Score: 57
GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV
3. L03A000083 From 46 To 77 E-value: 0.00003 Score: 38.9
GMWSTIRNVGKSAAKAANLPA-KAALGAISEAV
4. L01A002844 From 1 To 32 E-value: 0.00003 Score: 38.9
GMWSTIRNVGKSAAKAANLPA-KAALGAISEAV
5. L02A000937 From 1 To 29 E-value: 0.00006 Score: 38.1
GLWSKIKEAGK----AVLTAAGKAALGAVSDAV

Antibacterial Activities
1 Target: Microsporum canis IP 11 94 MIC: 10 μg/ml (3.14297 μM)
2 Target: Tricophyton rubrum IP 1400-82 MIC: 15 μg/ml (4.71446 μM)
3 Target: Arthroderma simii IP 1063-74 MIC: 30 μg/ml (9.42892 μM)
4 Target: Aspergillus fumigatus IP 1025-70 MIC: 125 μg/ml (39.2872 μM)
5 Target: Aerornonas caviae IP 67-16 T MIC: 60 μg/ml (18.8578 μM)
6 Target: Escherichia coli IP 76-24 MIC: 15 μg/ml (4.71446 μM)
7 Target: Nocardia brasiliensis IP 16-80 MIC: 30 μg/ml (9.42892 μM)
8 Target: Cryptococcus neoformans IP 960-67 MIC: 15 μg/ml (4.71446 μM)
9 Target: Cryptococcus neoformans IP 962-67 MIC: 15 μg/ml (4.71446 μM)
10 Target: Candida albicans IP 884-65 MIC: 15 μg/ml (4.71446 μM)
11 Target: E. coli MIC: 4.77255 μg/ml (1.5 μM)
12 Target: S. aureus MIC: 39.7712 μg/ml (12.5 μM)

Reference
[1] Moos M. Jr.,Gusovsky F.,Moni R.W.,Caceres J.,Daly J.W.,
Title:Frog secretions and hunting magic in the upper Amazon: identification of a peptide that interacts with an adenosine receptor.
Journal:Proc. Natl. Acad. Sci. U.S.A., 1992, 89, 10960-10963 [MEDLINE:93066363]
[2] Menez A.,Boulain J.-C.,Lajeunesse E.,Ducancel F.,Amiche M.,
Title:Molecular cloning of a cDNA encoding the precursor of adenoregulin from frog skin. Relationships with the vertebrate defensive peptides, dermaseptins.
Journal:Biochem. Biophys. Res. Commun., 1993, 191, 983-990 [MEDLINE:93221546]
[3] Daly J.W.,Lueders J.E.,Moni R.W.,Shin Y.,
Title:Effects of the amphiphilic peptides mastoparan and adenoregulin on receptor binding, G proteins, phosphoinositide breakdown, cyclic AMP generation, and calcium influx.
Journal:Cell. Mol. Neurobiol., 1994, 14, 133-157 [PubMed:7842473]
[4] Nicolas P.,Mor A.,
Title:Isolation and structure of novel defensive peptides from frog skin.
Journal:Eur. J. Biochem., 1994, 219, 145-154 [MEDLINE:94139686]
[5] Daly J.W.,Romero F.S.,Moni R.W.,
Title:The amphiphilic peptide adenoregulin enhances agonist binding to A1-adenosine receptors and 35SGTP gamma S to brain membranes.
Journal:Cell. Mol. Neurobiol., 1995, 15, 465-493 [PubMed:8565049]
[6] Wei D.,Luo Q.,Ma Y.,Zhou Y.,Cao W.,
Title:Expression and purification of antimicrobial peptide adenoregulin with C-amidated terminus in Escherichia coli.
Journal:Protein Expr. Purif., 2005, 40, 404-410 [PubMed:15766883]