Record in detail
General Info
- lamp_id:L01A000580
- Name:AMP1_MELGA
- FullName:Antimicrobial peptide THP1
- Source:Meleagris gallopavo
- Mass:3912.6 Da
- Sequence Length:35 aa
- Isoelectric Point:9.25
- Activity:Antibacterial
- Sequence
GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCC - Function:Bactericidal activity; inhibits S.aureus and E.coli.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ2753
- 2 Database:DBAASP 1360
- 3 Database:dbAMP dbAMP_03230
- 4 Database:DRAMP DRAMP03282
- 5 Database:SATPdb satpdb25231
- 6 Database:Uniprot P80391
- 7 Database:DEF DEF313
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000257 From 26 To 60 E-value: 0.000000000000001 Score: 73.6
GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCC - 2. L02A000266 From 1 To 35 E-value: 0.000000000000004 Score: 71.6
GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCC - 3. L01A000580 From 1 To 35 E-value: 0.000000000000005 Score: 71.6
GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCC - 4. L12A09054| From 26 To 60 E-value: 0.0000000003 Score: 55.8
GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCC - 5. L01A000658 From 1 To 35 E-value: 0.0000000005 Score: 55.1
GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCC
Structure
- Domains
- 1 Name:Defensin_beta-typ Interpro Link:IPR001855
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Harmon B.G.,Wunderlich J.,Beach G.G.,Evans E.W.,
- Title:Isolation of antimicrobial peptides from avian heterophils.
- Journal:J. Leukoc. Biol., 1994, 56, 661-665 [MEDLINE:95053386]
- [2] Jackwood M.W.,Harmon B.G.,Brockus C.W.,
- Title:Characterization of beta-defensin prepropeptide mRNA from chicken and turkey bone marrow.
- Journal:Anim. Genet., 1998, 29, 283-289 [MEDLINE:98418188]
Comments
- Comments
No comments found on LAMP database