Record in detail


General Info

  • lamp_id:L01A000584
  • Name:DFBC7_BOVIN
  • FullName:Beta-defensin C7
  • Source:Bos taurus
  • Mass:3876.8 Da
  • Sequence Length:35 aa
  • Isoelectric Point:10.74
  • Activity:Antibacterial
  • Sequence
        PLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCR
  • Function:Has bactericidal activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000070    From 17 To 51 E-value: 0.000000000000007 Score: 70.9
        PLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCR
  • 2. L05A0DEF83    From 2 To 36 E-value: 0.00000000000002 Score: 69.3
        PLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCR
  • 3. L01A000584    From 1 To 35 E-value: 0.00000000000003 Score: 68.9
        PLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCR
  • 4. L12A09080|    From 24 To 58 E-value: 0.0000000000003 Score: 65.5
        PLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCR
  • 5. L12A02357|    From 8 To 42 E-value: 0.0000000000003 Score: 65.5
        PLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCR

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Erdjument-Bromage H.,Russell J.P.,Diamond G.,Clark D.P.,Tarver A.P.,
  •   Title:Enteric beta-defensin: molecular cloning and characterization of a gene with inducible intestinal epithelial cell expression associated with Cryptosporidium parvum infection.
  •   Journal:Infect. Immun., 1998, 66, 1045-1056  [MEDLINE:98147718]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: