Record in detail
General Info
- lamp_id:L01A000586
- Name:DEFB9_BOVIN
- FullName:Beta-defensin 9
- Source:Bos taurus
- Mass:4558.4 Da
- Sequence Length:40 aa
- Isoelectric Point:11.17
- Activity:Antibacterial
- Sequence
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR - Function:Has bactericidal activity. Active against E.coli ML35 and S.aureus 502A.
Cross-Linking
- Cross-linking
- 1 Database:APD 44
- 2 Database:CAMP CAMPSQ546
- 3 Database:dbAMP dbAMP_10094
- 4 Database:DRAMP DRAMP02866
- 5 Database:SATPdb satpdb17584
- 6 Database:Uniprot P46167
- 7 Database:DEF DEF78
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000068 From 16 To 55 E-value: 2e-18 Score: 83.2
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR - 2. L12A02360| From 3 To 42 E-value: 6e-18 Score: 81.3
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR - 3. L01A000586 From 1 To 40 E-value: 6e-18 Score: 81.3
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR - 4. L12A09075| From 23 To 62 E-value: 1e-17 Score: 80.5
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPQIKCCR - 5. L12A09076| From 23 To 62 E-value: 3e-17 Score: 78.6
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPRIKCCR
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Novotny M.J.,McGuire P.A.,Morris W.L.,Tang Y.-Q.,Selsted M.E.,
- Title:Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.
- Journal:J. Biol. Chem., 1993, 268, 6641-6648 [MEDLINE:93203264]
- [2] Erdjument-Bromage H.,Russell J.P.,Diamond G.,Clark D.P.,Tarver A.P.,
- Title:Enteric beta-defensin: molecular cloning and characterization of a gene with inducible intestinal epithelial cell expression associated with Cryptosporidium parvum infection.
- Journal:Infect. Immun., 1998, 66, 1045-1056 [MEDLINE:98147718]
Comments
- Comments
No comments found on LAMP database