Record in detail


General Info

  • lamp_id:L01A000594
  • Name:DEF4_ANDAU
  • FullName:4 kDa defensin
  • Source:Androctonus australis
  • Mass:4211.8 Da
  • Sequence Length:37 aa
  • Isoelectric Point:9.59
  • Activity:Antibacterial
  • Sequence
        GFGCPFNQGACHRHCRSIRRRGGYCAGLFKQTCTCYR
  • Function:Active against Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000594    From 1 To 37 E-value: 1e-16 Score: 76.6
        GFGCPFNQGACHRHCRSIRRRGGYCAGLFKQTCTCYR
  • 2. L01A000718    From 1 To 37 E-value: 4e-16 Score: 75.1
        GFGCPFNQGACHRHCRSIRRRGGYCAGLIKQTCTCYR
  • 3. L12A01314|    From 14 To 50 E-value: 0.000000000000001 Score: 73.6
        GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCTCYR
  • 4. L01A003006    From 1 To 37 E-value: 0.000000000000001 Score: 73.2
        GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCTCYR
  • 5. L03A000241    From 37 To 73 E-value: 0.000000000000002 Score: 72.4
        GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCYR

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hoffmann J.A.,Fehlbaum P.,Goyffon M.,Loew D.,Ehret-Sabatier L.,
  •   Title:Characterization of novel cysteine-rich antimicrobial peptides from scorpion blood.
  •   Journal:J. Biol. Chem., 1996, 271, 29537-29544  [MEDLINE:97094646]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: