Record in detail


General Info

  • lamp_id:L01A000595
  • Name:GLL1_CHICK
  • FullName:Gallinacin-1
  • Source:Gallus gallus
  • Mass:4510.4 Da
  • Sequence Length:39 aa
  • Isoelectric Point:10.03
  • Activity:Antibacterial, Antifungal
  • Sequence
        GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIW
  • Function:Has bactericidal activity. Potent activity against E.coli ML-35, L.monocytogenes EGD and C.albicans.

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  299
  •   2  Database:CAMP  CAMPSQ555
  •   3  Database:DBAASP  4999
  •   4  Database:dbAMP  dbAMP_03997
  •   5  Database:SATPdb  satpdb15382
  •   6  Database:Uniprot  P46156

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000259    From 26 To 64 E-value: 7e-18 Score: 80.9
        GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIW
  • 2. L01A000595    From 1 To 39 E-value: 3e-17 Score: 78.6
        GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIW
  • 3. L05ADEF109    From 1 To 39 E-value: 4e-17 Score: 78.6
        GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIW
  • 4. L12A09054|    From 26 To 64 E-value: 2e-16 Score: 76.3
        GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIW
  • 5. L01A000708    From 1 To 38 E-value: 4e-16 Score: 75.5
        GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRI

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lee T.D.,Tan L.,Kokryakov V.N.,Swiderek K.M.,Harwig S.S.L.,
  •   Title:Gallinacins: cysteine-rich antimicrobial peptides of chicken leukocytes.
  •   Journal:FEBS Lett., 1994, 342, 281-285  [MEDLINE:94200386]
  •   [2]  Jackwood M.W.,Harmon B.G.,Brockus C.W.,
  •   Title:Characterization of beta-defensin prepropeptide mRNA from chicken and turkey bone marrow.
  •   Journal:Anim. Genet., 1998, 29, 283-289  [MEDLINE:98418188]
  •   [3]  Cheng J.-F.,Matsuda Y.,Ando J.,Hughes A.L.,Xiao Y.,
  •   Title:A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.
  •   Journal:BMC Genomics, 2004, 5, 56-56  [PubMed:15310403]
  •   [4]  James T.,Tierney J.,Gaines S.,Higgs R.,Lynn D.J.,
  •   Title:Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.
  •   Journal:Immunogenetics, 2004, 56, 170-177  [PubMed:15148642]
  •   [5]  Isobe N.,Nishibori M.,Subedi K.,Ohashi H.,Yoshimura Y.,
  •   Title:Effects of age, egg-laying activity, and Salmonella-inoculation on the expressions of gallinacin mRNA in the vagina of the hen oviduct.
  •   Journal:J. Reprod. Dev., 2006, 52, 211-218  [PubMed:16394622]
  •   [6]  Yoshimura Y.,Nishibori M.,Isobe N.,Subedi K.,
  •   Title:Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).
  •   Journal:Reproduction, 2007, 133, 127-133  [PubMed:17244739]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: