Record in detail


General Info

  • lamp_id:L01A000596
  • Name:LEB3_BOMMO
  • FullName:Lebocin-3
  • Source:Bombyx mori
  • Mass:3789.5 Da
  • Sequence Length:32 aa
  • Isoelectric Point:10.17
  • Activity:Antibacterial
  • Sequence
        DLRFLYPRGKLPVPTLPPFNPKPIYIDMGNRY
  • Function:Antibacterial peptide.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000596    From 1 To 32 E-value: 0.0000000000004 Score: 65.5
        DLRFLYPRGKLPVPTLPPFNPKPIYIDMGNRY
  • 2. L01A000312    From 1 To 32 E-value: 0.00000000009 Score: 57.4
        DLRFWNPREKLPLPTLPPFNPKPIYIDMGNRY
  • 3. L01A000222    From 1 To 32 E-value: 0.00001 Score: 40
        DLRFLYPRGKLPVPTPPPFNPKPIYIDMGNRY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Yamakawa M.,Hara S.,
  •   Title:A novel antibacterial peptide family isolated from the silkworm, Bombyx mori.
  •   Journal:Biochem. J., 1995, 310, 651-656  [MEDLINE:95382787]
  •   [2]  Shono T.,Hara S.,Ishibashi J.,Taniai K.,Furukawa S.,
  •   Title:A novel member of lebocin gene family from the silkworm, Bombyx mori.
  •   Journal:Biochem. Biophys. Res. Commun., 1997, 238, 769-774  [MEDLINE:97472285]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: