Record in detail
General Info
- lamp_id:L01A000599
- Name:SAKA_LACSK
- FullName:Bacteriocin sakacin-A
- Source:Lactobacillus sakei
- Mass:4308.9 Da
- Sequence Length:41 aa
- Isoelectric Point:9.37
- Activity:Antibacterial
- Sequence
ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM - Function:Bactericidal activity; inhibits closely related Lactobacilli, Listeria monocytogenes and ivanovvi, Enterococcus faecalis, Carnobacterium sp and Brocothrix thermosphacta.
Cross-Linking
- Cross-linking
- 1 Database:APD 637
- 2 Database:CAMP CAMPSQ1829
- 3 Database:dbAMP dbAMP_00543
- 4 Database:DRAMP DRAMP00080
- 5 Database:SATPdb satpdb19474
- 6 Database:Uniprot P0A310
- 7 Database:BAC BAC065
- 8 Database:BAC BAC066
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A08830| From 19 To 59 E-value: 4e-19 Score: 85.1
ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM - 2. L01A000599 From 1 To 41 E-value: 9e-19 Score: 84
ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM - 3. L13A017213 From 1 To 41 E-value: 5e-18 Score: 81.3
ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGKAGM - 4. L12A09063| From 30 To 69 E-value: 0.0000000000002 Score: 66.6
RSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGM - 5. L01A000321 From 3 To 42 E-value: 0.0000000000003 Score: 65.5
RSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGM
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Blom H.,Aukrust T.,Birkeland S.-E.,Axelsson L.,Holck A.L.,
- Title:Purification and amino acid sequence of sakacin A, a bacteriocin from Lactobacillus sake Lb706.
- Journal:J. Gen. Microbiol., 1992, 138, 2715-2720 [MEDLINE:93139766]
- [2] Holck A.,Axelsson L.,
- Title:The genes involved in production of and immunity to sakacin A, a bacteriocin from Lactobacillus sake Lb706.
- Journal:J. Bacteriol., 1995, 177, 2125-2137 [MEDLINE:95238285]
Comments
- Comments
No comments found on LAMP database