Record in detail


General Info

  • lamp_id:L01A000599
  • Name:SAKA_LACSK
  • FullName:Bacteriocin sakacin-A
  • Source:Lactobacillus sakei
  • Mass:4308.9 Da
  • Sequence Length:41 aa
  • Isoelectric Point:9.37
  • Activity:Antibacterial
  • Sequence
        ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM
  • Function:Bactericidal activity; inhibits closely related Lactobacilli, Listeria monocytogenes and ivanovvi, Enterococcus faecalis, Carnobacterium sp and Brocothrix thermosphacta.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08830|    From 19 To 59 E-value: 4e-19 Score: 85.1
        ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM
  • 2. L01A000599    From 1 To 41 E-value: 9e-19 Score: 84
        ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM
  • 3. L13A017213    From 1 To 41 E-value: 5e-18 Score: 81.3
        ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGKAGM
  • 4. L12A09063|    From 30 To 69 E-value: 0.0000000000002 Score: 66.6
        RSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGM
  • 5. L01A000321    From 3 To 42 E-value: 0.0000000000003 Score: 65.5
        RSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASGLAGM

Structure

  •   Domains
  •   1  Name:Bacteriocin_IIa    Interpro Link:IPR002633
  •   2  Name:Bacteriocin_IIa_CS    Interpro Link:IPR023384
  •   3  Name:Bacteriocin_IIa_dom    Interpro Link:IPR023388
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Blom H.,Aukrust T.,Birkeland S.-E.,Axelsson L.,Holck A.L.,
  •   Title:Purification and amino acid sequence of sakacin A, a bacteriocin from Lactobacillus sake Lb706.
  •   Journal:J. Gen. Microbiol., 1992, 138, 2715-2720  [MEDLINE:93139766]
  •   [2]  Holck A.,Axelsson L.,
  •   Title:The genes involved in production of and immunity to sakacin A, a bacteriocin from Lactobacillus sake Lb706.
  •   Journal:J. Bacteriol., 1995, 177, 2125-2137  [MEDLINE:95238285]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: