Record in detail
General Info
- lamp_id:L01A000601
- Name:DEFB_MYTED
- FullName:Defensin-B
- Source:Mytilus edulis
- Mass:3829.3 Da
- Sequence Length:35 aa
- Isoelectric Point:8.62
- Activity:Antibacterial
- Sequence
GFGCPNDYPCHRHCKSIPGRYGGYCGGXHRLRCTC - Function:Has antibacterial activity against M.luteus and E.coli.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ561
- 2 Database:dbAMP dbAMP_02566
- 3 Database:DRAMP DRAMP02804
- 4 Database:Uniprot P81611
- 5 Database:AMD DEFB_MYTED
- 6 Database:DEF DEF170
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L02A000710 From 1 To 35 E-value: 0.000000000000007 Score: 70.9
GFGCPNDYPCHRHCKSIPGRYGGYCGGAHRLRCTC - 2. L01A000601 From 1 To 35 E-value: 0.00000000000001 Score: 70.1
GFGCPNDYPCHRHCKSIPGRYGGYCGGXHRLRCTC - 3. L02A000709 From 1 To 35 E-value: 0.00000000000004 Score: 68.6
GFGCPNDYPCHRHCKSIPGRAGGYCGGAHRLRCTC - 4. L03A000030 From 1 To 35 E-value: 0.0000000000001 Score: 66.6
GFGCPNDYPCHRHCKSIPGRCGGYCGGWHRLRCTC - 5. L12A02572| From 1 To 35 E-value: 0.0000000000006 Score: 64.7
GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTC
Structure
- Domains
- 1 Name:Defensin_invertebrate/fungal Interpro Link:IPR001542
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Hoffman J.A.,Hetru C.,Philippe H.,Chernysh S.,Charlet M.,
- Title:Innate immunity. Isolation of several cysteine-rich antimicrobial peptides from the blood of a mollusc, Mytilus edulis.
- Journal:J. Biol. Chem., 1996, 271, 21808-21813 [MEDLINE:96355569]
Comments
- Comments
No comments found on LAMP database