Record in detail


General Info

  • lamp_id:L01A000604
  • Name:MYTB_MYTED
  • FullName:Mytilin-B
  • Source:Mytilus edulis
  • Mass:3981.7 Da
  • Sequence Length:34 aa
  • Isoelectric Point:9.48
  • Activity:Antibacterial, Antiviral
  • Sequence
        SCASRCKGHCRARRCGYYVSVLYRGRCYCKCLRC
  • Function:Has antibacterial and antiviral activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000604    From 1 To 34 E-value: 0.0000000000006 Score: 64.7
        SCASRCKGHCRARRCGYYVSVLYRGRCYCKCLRC
  • 2. L03A000350    From 3 To 36 E-value: 0.0000004 Score: 45.1
        TCGSLCKAHCTFRKCGYFMSVLYGHRCYCRCLLC
  • 3. L01A000603    From 2 To 34 E-value: 0.000004 Score: 42
        CASRCKAKCAGRRCKGWASASFRGRCYCKCFRC
  • 4. L03A000029    From 2 To 34 E-value: 0.00004 Score: 38.9
        CASRCKAKCAGRRCKGWASASFRRRCYCKCFRC
  • 5. L13A013493    From 1 To 33 E-value: 0.00007 Score: 37.7
        GCASRCKAKCAGRRCKGWASA-FRGRCYCKCFRC

Structure

  •   Domains
  •   1  Name:Myticin_preproprotein    Interpro Link:IPR019631
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hoffman J.A.,Hetru C.,Philippe H.,Chernysh S.,Charlet M.,
  •   Title:Innate immunity. Isolation of several cysteine-rich antimicrobial peptides from the blood of a mollusc, Mytilus edulis.
  •   Journal:J. Biol. Chem., 1996, 271, 21808-21813  [MEDLINE:96355569]
  •   [2]  Aumelas A.,Toubiana M.,Yang Y.,Roch P.,
  •   Title:NMR structure of mussel mytilin, and antiviral-antibacterial activities of derived synthetic peptides.
  •   Journal:Dev. Comp. Immunol., 2008, 32, 227-238  [PubMed:17628674]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: