Record in detail


General Info

  • lamp_id:L01A000610
  • Name:DEFB1_MOUSE
  • FullName:Beta-defensin 1
  • Source:Mus musculus
  • Mass:4076.6 Da
  • Sequence Length:37 aa
  • Isoelectric Point:8.63
  • Activity:Antibacterial
  • Sequence
        DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001449    From 33 To 69 E-value: 2e-17 Score: 79.3
        DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS
  • 2. L01A000610    From 1 To 37 E-value: 1e-16 Score: 77
        DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS
  • 3. L03A000174    From 33 To 69 E-value: 0.000000000000001 Score: 73.2
        DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS
  • 4. L01A003051    From 1 To 37 E-value: 0.000000000000005 Score: 71.2
        DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS
  • 5. L03A000296    From 33 To 68 E-value: 0.0000008 Score: 44.3
        DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bevins C.L.,Kozak C.A.,Huttner K.M.,
  •   Title:The mouse genome encodes a single homolog of the antimicrobial peptide human beta-defensin 1.
  •   Journal:FEBS Lett., 1997, 413, 45-49  [MEDLINE:97431609]
  •   [2]  Vivado A.,Lee S.K.,Schutte B.C.,Wowk S.A.,Jia H.P.,
  •   Title:A novel murine beta-defensin expressed in tongue, esophagus, and trachea.
  •   Journal:J. Biol. Chem., 2000, 275, 33314-33320  [MEDLINE:20517883]
  •   [3]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: