Record in detail
General Info
- lamp_id:L01A000610
- Name:DEFB1_MOUSE
- FullName:Beta-defensin 1
- Source:Mus musculus
- Mass:4076.6 Da
- Sequence Length:37 aa
- Isoelectric Point:8.63
- Activity:Antibacterial
- Sequence
DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS - Function:Has bactericidal activity (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:APD 272
- 2 Database:CAMP CAMPSQ570
- 3 Database:dbAMP dbAMP_01181
- 4 Database:DRAMP DRAMP03366
- 5 Database:SATPdb satpdb12410
- 6 Database:Uniprot P56386
- 7 Database:DEF DEF103
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A001449 From 33 To 69 E-value: 2e-17 Score: 79.3
DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS - 2. L01A000610 From 1 To 37 E-value: 1e-16 Score: 77
DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS - 3. L03A000174 From 33 To 69 E-value: 0.000000000000001 Score: 73.2
DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS - 4. L01A003051 From 1 To 37 E-value: 0.000000000000005 Score: 71.2
DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS - 5. L03A000296 From 33 To 68 E-value: 0.0000008 Score: 44.3
DHYNCVRSGGQCLYSACPIYTKIQGTCYHGKAKCCK
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Bevins C.L.,Kozak C.A.,Huttner K.M.,
- Title:The mouse genome encodes a single homolog of the antimicrobial peptide human beta-defensin 1.
- Journal:FEBS Lett., 1997, 413, 45-49 [MEDLINE:97431609]
- [2] Vivado A.,Lee S.K.,Schutte B.C.,Wowk S.A.,Jia H.P.,
- Title:A novel murine beta-defensin expressed in tongue, esophagus, and trachea.
- Journal:J. Biol. Chem., 2000, 275, 33314-33320 [MEDLINE:20517883]
- [3]
- Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
- Journal:Genome Res., 2004, 14, 2121-2127 [PubMed:15489334]
Comments
- Comments
No comments found on LAMP database