Record in detail
General Info
- lamp_id:L01A000632
- Name:DFB38_MOUSE
- FullName:Beta-defensin 38
- Source:Mus musculus
- Mass:4954.8 Da
- Sequence Length:42 aa
- Isoelectric Point:9.32
- Activity:Antibacterial
- Sequence
IGPDTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQKRY - Function:Synthetic Defb38 kills both Gram-negative (E.coli and P.aeruginosa) and Gram-positive (E.faecium) bacteria.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ592
- 2 Database:dbAMP dbAMP_04612
- 3 Database:DRAMP DRAMP03393
- 4 Database:SATPdb satpdb12124
- 5 Database:Uniprot Q7TNV7
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A07933| From 22 To 63 E-value: 6e-21 Score: 90.9
IGPDTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQKRY - 2. L01A000632 From 1 To 42 E-value: 3e-20 Score: 88.6
IGPDTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQKRY - 3. L01A003606 From 4 To 42 E-value: 0.00000000000005 Score: 68.2
DTAKCVQKKNVCYYFECPWLSISVSTCYKGKAKCCQKRY - 4. L05ADEF342 From 23 To 62 E-value: 0.00000000007 Score: 57.8
GLDTMKCVRGKNNCHMHRCPWFFVLISTCYSGKGSCCQKR - 5. L03A000152 From 25 To 62 E-value: 0.0000000004 Score: 55.1
DTIKCLQGNNNCHIQKCPWFLLQVSTCYKGKGRCCQKR
Structure
- Domains
- 1 Name:Defensin_beta-typ Interpro Link:IPR001855
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Marquez G.,Martinez-A C.,Albar J.P.,Villares R.,Zaballos A.,
- Title:Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.
- Journal:J. Biol. Chem., 2004, 279, 12421-12426 [PubMed:14718547]
Comments
- Comments
No comments found on LAMP database