Record in detail


General Info

  • lamp_id:L01A000634
  • Name:Cathelicidin-related antimicrobial peptide
  • FullName:Cathelicidin-related antimicrobial peptide
  • Source:Chinchilla lanigera
  • Mass:5009 Da
  • Sequence Length:42 aa
  • Isoelectric Point:12.65
  • Activity:Antibacterial
  • Sequence
        AKRGGFWRKVGRKLGKGIRKIGKTIKSQLGKFRPRLQYRYQF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000634    From 1 To 42 E-value: 8e-18 Score: 80.9
        AKRGGFWRKVGRKLGKGIRKIGKTIKSQLGKFRPRLQYRYQF
  • 2. L01A003237    From 3 To 36 E-value: 0.0006 Score: 34.7
        GGILRKAGEKIGGGLKKIGQKIKDFFGKLAPRTE
  • 3. L01A002750    From 3 To 36 E-value: 0.0006 Score: 34.7
        GNFFRKAKKKIGRGLKKIGQKIKDFLGNLVPRTE
  • 4. L01A002737    From 3 To 34 E-value: 0.001 Score: 33.5
        GNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPR
  • 5. L01A003251    From 3 To 36 E-value: 0.005 Score: 31.6
        GGFLQKAREKIARGFKKIGQKINDFLGKLAPRTE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: