Record in detail
General Info
- lamp_id:L01A000646
- Name:ES2A_RANES
- FullName:Esculentin-2A
- Source:Rana esculenta
- Mass:3713.6 Da
- Sequence Length:37 aa
- Isoelectric Point:10.41
- Activity:Antibacterial
- Sequence
GILSLVKGVAKLAGKGLAKEGGKFGLELIACKIAKQC - Function:Shows antibacterial activity against representative Gram-negative and Gram-positive bacterial species, and hemolytic activity.
Cross-Linking
- Cross-linking
- 1 Database:APD 83
- 2 Database:CAMP CAMPSQ606
- 3 Database:DBAASP 1272
- 4 Database:dbAMP dbAMP_03086
- 5 Database:DRAMP DRAMP01490
- 6 Database:SATPdb satpdb27386
- 7 Database:Uniprot P40845
- 8 Database:AMD ES2A_RANES
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000646 From 1 To 37 E-value: 0.00000000000006 Score: 67.8
GILSLVKGVAKLAGKGLAKEGGKFGLELIACKIAKQC - 2. L01A000647 From 1 To 37 E-value: 0.0000000000004 Score: 65.1
GIFSLVKGAAKLAGKGLAKEGGKFGLELIACKIAKQC - 3. L01A003348 From 1 To 37 E-value: 0.000000000007 Score: 60.8
GIFSLVKGVAKLAGKTLAKEGGKFGLELAMCKIAKQC - 4. L01A003349 From 1 To 37 E-value: 0.0000000001 Score: 57
GILSLVKGAAKLLGKGLAKEGGKVGLEFIACKVTNQC - 5. L01A003347 From 1 To 36 E-value: 0.0000000005 Score: 55.1
GILSLVK-VAKLAGKTFAKEGGKFGLEFIACKVTNQC
Structure
- Domains
- 1 Name:Antimicrobial_frog_2 Interpro Link:IPR012521
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: E. coli D21 MIC: 1.49 μg/ml (0.401228 μM)
- 2 Target: B. megaterium BmII MIC: 0.74 μg/ml (0.199268 μM)
- 3 Target: S. aureus Cowan 1 MIC: 2.97 μg/ml (0.799763 μM)
- 4 Target: P.aeruginosa ATCC15692 MIC: 13 μg/ml (3.50065 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Bossa F.,Barra D.,Mignogna G.,Simmaco M.,
- Title:Antimicrobial peptides from skin secretions of Rana esculenta. Molecular cloning of cDNAs encoding esculentin and brevinins and isolation of new active peptides.
- Journal:J. Biol. Chem., 1994, 269, 11956-11961 [MEDLINE:94216303]
Comments
- Comments
No comments found on LAMP database