Record in detail


General Info

  • lamp_id:L01A000646
  • Name:ES2A_RANES
  • FullName:Esculentin-2A
  • Source:Rana esculenta
  • Mass:3713.6 Da
  • Sequence Length:37 aa
  • Isoelectric Point:10.41
  • Activity:Antibacterial
  • Sequence
        GILSLVKGVAKLAGKGLAKEGGKFGLELIACKIAKQC
  • Function:Shows antibacterial activity against representative Gram-negative and Gram-positive bacterial species, and hemolytic activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000646    From 1 To 37 E-value: 0.00000000000006 Score: 67.8
        GILSLVKGVAKLAGKGLAKEGGKFGLELIACKIAKQC
  • 2. L01A000647    From 1 To 37 E-value: 0.0000000000004 Score: 65.1
        GIFSLVKGAAKLAGKGLAKEGGKFGLELIACKIAKQC
  • 3. L01A003348    From 1 To 37 E-value: 0.000000000007 Score: 60.8
        GIFSLVKGVAKLAGKTLAKEGGKFGLELAMCKIAKQC
  • 4. L01A003349    From 1 To 37 E-value: 0.0000000001 Score: 57
        GILSLVKGAAKLLGKGLAKEGGKVGLEFIACKVTNQC
  • 5. L01A003347    From 1 To 36 E-value: 0.0000000005 Score: 55.1
        GILSLVK-VAKLAGKTFAKEGGKFGLEFIACKVTNQC

Structure

  •   Domains
  •   1  Name:Antimicrobial_frog_2    Interpro Link:IPR012521
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli D21  MIC:  1.49 μg/ml  (0.401228 μM)  
  •   2  Target:  B. megaterium BmII  MIC:  0.74 μg/ml  (0.199268 μM)  
  •   3  Target:  S. aureus Cowan 1  MIC:  2.97 μg/ml  (0.799763 μM)  
  •   4  Target:  P.aeruginosa ATCC15692  MIC:  13 μg/ml  (3.50065 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bossa F.,Barra D.,Mignogna G.,Simmaco M.,
  •   Title:Antimicrobial peptides from skin secretions of Rana esculenta. Molecular cloning of cDNAs encoding esculentin and brevinins and isolation of new active peptides.
  •   Journal:J. Biol. Chem., 1994, 269, 11956-11961  [MEDLINE:94216303]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: