Record in detail
General Info
- lamp_id:L01A000647
- Name:ES2B_RANES
- FullName:Esculentin-2B
- Source:Rana esculenta
- Mass:3719.5 Da
- Sequence Length:37 aa
- Isoelectric Point:10.41
- Activity:Antibacterial
- Sequence
GIFSLVKGAAKLAGKGLAKEGGKFGLELIACKIAKQC - Function:Shows antibacterial activity against representative Gram-negative and Gram-positive bacterial species, and hemolytic activity.
Cross-Linking
- Cross-linking
- 1 Database:APD 84
- 2 Database:CAMP CAMPSQ607
- 3 Database:dbAMP dbAMP_02868
- 4 Database:DRAMP DRAMP01492
- 5 Database:SATPdb satpdb19885
- 6 Database:Uniprot P40846
- 7 Database:AMD ES2B_RANES
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000647 From 1 To 37 E-value: 0.00000000000004 Score: 68.6
GIFSLVKGAAKLAGKGLAKEGGKFGLELIACKIAKQC - 2. L01A000646 From 1 To 37 E-value: 0.0000000000004 Score: 65.1
GILSLVKGVAKLAGKGLAKEGGKFGLELIACKIAKQC - 3. L01A003348 From 1 To 37 E-value: 0.000000000005 Score: 61.2
GIFSLVKGVAKLAGKTLAKEGGKFGLELAMCKIAKQC - 4. L01A003349 From 1 To 37 E-value: 0.00000000007 Score: 57.8
GILSLVKGAAKLLGKGLAKEGGKVGLEFIACKVTNQC - 5. L01A003369 From 1 To 37 E-value: 0.0000000004 Score: 55.5
GIFSLIKGAAQLIGKTVAKEAGKTGLELMACKVTKQC
Structure
- Domains
- 1 Name:Antimicrobial_frog_2 Interpro Link:IPR012521
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Bossa F.,Barra D.,Mignogna G.,Simmaco M.,
- Title:Antimicrobial peptides from skin secretions of Rana esculenta. Molecular cloning of cDNAs encoding esculentin and brevinins and isolation of new active peptides.
- Journal:J. Biol. Chem., 1994, 269, 11956-11961 [MEDLINE:94216303]
Comments
- Comments
No comments found on LAMP database