Record in detail


General Info

  • lamp_id:L01A000664
  • Name:P90683_ASCSU
  • FullName:
  • Source:Ascaris suum
  • Mass:7576.6 Da
  • Sequence Length:72 aa
  • Isoelectric Point:9.04
  • Activity:Antibacterial
  • Sequence
        AVDFSSCARMDVPGLSKVAQGLCISSCKFQNCGTGHCEKRGGRPTCVCDRCGRGGGEWPSVPMPKGRSSRGR
  • Function:null

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000170    From 19 To 90 E-value: 4e-38 Score: 148
        AVDFSSCARMDVPGLSKVAQGLCISSCKFQNCGTGHCEKRGGRPTCVCDRCGRGGGEWPSVPMPKGRSSRGR
  • 2. L02A001523    From 1 To 72 E-value: 3e-37 Score: 145
        AVDFSSCARMDVPGLSKVAQGLCISSCKFQNCGTGHCEKRGGRPTCVCDRCGRGGGEWPSVPMPKGRSSRGR
  • 3. L01A000664    From 1 To 72 E-value: 4e-37 Score: 144
        AVDFSSCARMDVPGLSKVAQGLCISSCKFQNCGTGHCEKRGGRPTCVCDRCGRGGGEWPSVPMPKGRSSRGR
  • 4. L11A001319    From 1 To 71 E-value: 1e-36 Score: 143
        AVDFSSCARMDVPGLSKVAQGLCISSCKFQNCGTGHCEKRGGRPTCVCDRCGRGGGEWPSVPMPKGRSSRG
  • 5. L12A00699|    From 1 To 53 E-value: 3e-26 Score: 108
        AVDFSSCARMDVPGLSKVAQGLCISSCKFQNCGTGHCEKRGGRPTCVCDRCGR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli JM109  IC50:  50 μg/ml  (6.59927 μM)  
  •   2  Target:  Proteus vulgaris ATCC 13315  IC50:  10 μg/ml  (1.31985 μM)  
  •   3  Target:  Staphylococcus aureus ATCC6538P  IC50:  0.6 μg/ml  (0.0791912 μM)  
  •   4  Target:  Bacillus subtilis ATCC6633  IC50:  1.2 μg/ml  (0.158382 μM)  
  •   5  Target:  Micrococcus luteus ATCC398  IC50:  0.8 μg/ml  (0.105588 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Komatsu S.,Kato Y.,
  •   Title:ASABF, a novel cysteine-rich antibacterial peptide isolated from the nematode Ascaris suum. Purification, primary structure, and molecular cloning of cDNA.
  •   Journal:J. Biol. Chem., 1996, 271, 30493-30498  [MEDLINE:97094782]
  •   [2]  Suzuki M.,Murakami R.,Aizawa T.,Yoshida S.,Zhang H.,
  •   Title:In vitro antimicrobial properties of recombinant ASABF, an antimicrobial peptide isolated from the nematode Ascaris suum.
  •   Journal:Antimicrob. Agents Chemother., 2000, 44, 2701-2705  [MEDLINE:20448739]
  •   [3]  Nitta K.,Kawano K.,Hoshino H.,Aizawa T.,Kato Y.,
  •   Title:abf-1 and abf-2, ASABF-type antimicrobial peptide genes in Caenorhabditis elegans.
  •   Journal:Biochem. J., 2002, 361, 221-230  [MEDLINE:21633952]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: