Record in detail


General Info

  • lamp_id:L01A000671
  • Name:ENA2_HORSE
  • FullName:Antimicrobial peptide eNAP-2
  • Source:Equus caballus
  • Mass:4769.4 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.13
  • Activity:Antibacterial
  • Sequence
        EVERKHPLGGSRPGRCPTVPPGTFGHCACLCTGDASEPKGQKCCSN
  • Function:Has antibiotic activity against several equine uterine pathogens; S.zooepidemicus, E.coli and P.aeruginosa. Highly efficient against S.zoopedemicus. Not active against K.pneumoniae. Selectively inactivates microbial serine proteases (subtilisin A and proteinase K) without inhibiting mammalian serine proteases (human neutrophil elastase, human cathepsin G and bovine pancreatic trypsin).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000671    From 1 To 46 E-value: 6e-22 Score: 94.4
        EVERKHPLGGSRPGRCPTVPPGTFGHCACLCTGDASEPKGQKCCSN
  • 2. L01A003582    From 4 To 40 E-value: 0.06 Score: 28.1
        RPGSCPNVDVPIPPLGLCRTTCQTDANCQEGRKCCKN
  • 3. L01A003633    From 3 To 39 E-value: 0.24 Score: 26.2
        KSGSCPDMSMPIPPLGICKTLCNSDSGCPNVQKCCKN
  • 4. L01A003579    From 4 To 40 E-value: 0.78 Score: 24.3
        KAGSCPDVNQPIPPLGLCRNMCESDSGCPNNEKCCKN
  • 5. L01A003580    From 4 To 40 E-value: 0.94 Score: 23.9
        KAGSCPDVNQPIPPLGVCKTTCATDSNCPDIQKCCKN

Structure

  •   Domains
  •   1  Name:Whey_acidic_protein_4-diS_core    Interpro Link:IPR008197
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lehrer R.I.,Hughes J.P.,Cullor J.S.,Harwig S.S.L.,Couto M.A.,
  •   Title:eNAP-2, a novel cysteine-rich bactericidal peptide from equine leukocytes.
  •   Journal:Infect. Immun., 1992, 60, 5042-5047  [MEDLINE:93084348]
  •   [2]  Lehrer R.I.,Harwig S.S.L.,Couto M.A.,
  •   Title:Selective inhibition of microbial serine proteases by eNAP-2, an antimicrobial peptide from equine neutrophils.
  •   Journal:Infect. Immun., 1993, 61, 2991-2994  [MEDLINE:93293322]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: