Record in detail


General Info

  • lamp_id:L01A000673
  • Name:DEF2_MACMU
  • FullName:Neutrophil defensin 2
  • Source:Macaca mulatta
  • Mass:3471.1 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.37
  • Activity:Antibacterial, Antifungal
  • Sequence
        ACYCRIPACLAGERRYGTCFYMGRVWAFCC
  • Function:Has bacteriostatic activity against L.monocytogenes, E.coli and S.aureus, microbicidial activity against L.monocytogenes and S.aureus and antifungal activity against C.neoformans.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09212|    From 67 To 96 E-value: 0.00000000000005 Score: 68.2
        ACYCRIPACLAGERRYGTCFYMGRVWAFCC
  • 2. L03A000288    From 67 To 96 E-value: 0.0000000000001 Score: 67
        ACYCRIPACLAGERRYGTCFYLGRVWAFCC
  • 3. L05A0DEF60    From 67 To 96 E-value: 0.0000000000001 Score: 67
        ACYCRIPACLAGERRYGTCFYLGRVWAFCC
  • 4. L12A09257|    From 67 To 96 E-value: 0.0000000000001 Score: 67
        ACYCRIPACLAGERRYGTCFYLGRVWAFCC
  • 5. L12A09256|    From 65 To 94 E-value: 0.0000000000001 Score: 67
        ACYCRIPACLAGERRYGTCFYLGRVWAFCC

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   3  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Selsted M.E.,Miller C.J.,Yuan J.,Tang Y.Q.,
  •   Title:Isolation, characterization, cDNA cloning, and antimicrobial properties of two distinct subfamilies of alpha-defensins from rhesus macaque leukocytes.
  •   Journal:Infect. Immun., 1999, 67, 6139-6144  [MEDLINE:20002603]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: