Record in detail


General Info

  • lamp_id:L01A000717
  • Name:DEF2_MESAU
  • FullName:Neutrophil defensin 2
  • Source:Mesocricetus auratus
  • Mass:3621.2 Da
  • Sequence Length:31 aa
  • Isoelectric Point:8.38
  • Activity:Antibacterial, Antifungal
  • Sequence
        CFCKRPVCDSGETQIGYCRLGNTFYRLCCRQ
  • Function:Bactericidal activity, greater against Gram-positive bacteria. Low anti-fungi activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000418    From 3 To 33 E-value: 0.0000000000002 Score: 66.2
        CFCKRPVCDSGETQIGYCRLGNTFYRLCCRQ
  • 2. L01A000717    From 1 To 31 E-value: 0.0000000000002 Score: 65.9
        CFCKRPVCDSGETQIGYCRLGNTFYRLCCRQ
  • 3. L01A000416    From 3 To 33 E-value: 0.0000004 Score: 45.1
        CFCRRRGCASRERHIGYCRFGNTIYRLCCRR
  • 4. L01A000417    From 3 To 33 E-value: 0.000007 Score: 41.2
        CFCRRRGCASRERLIGYCRFGNTIYGLCCRR
  • 5. L12A00633|    From 3 To 32 E-value: 0.003 Score: 32.3
        CYCRRGRCATRESLSGVCRISGRLYRLCCR

Structure

  •   Domains
  •   1  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   2  Name:Mammalian_defensins    Interpro Link:IPR006081
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dubin A.,Thogersen I.B.,Wojcik K.,Mak P.,
  •   Title:Isolation, antimicrobial activities, and primary structures of hamster neutrophil defensins.
  •   Journal:Infect. Immun., 1996, 64, 4444-4449  [MEDLINE:97045125]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: