Record in detail


General Info

  • lamp_id:L01A000837
  • Name:Sequence 12 from patent US 7314858
  • FullName:Sequence 12 from patent US 7314858
  • Source:Synthetic
  • Mass:6304.9 Da
  • Sequence Length:59 aa
  • Isoelectric Point:4.58
  • Activity:Antimicrobial
  • Sequence
        AQAEPLQARADEAAAQEQPGADDQEMAHAFTWHESAALPLSDSARGLRCICGRGICRLL
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000837    From 1 To 59 E-value: 3e-29 Score: 119
        AQAEPLQARADEAAAQEQPGADDQEMAHAFTWHESAALPLSDSARGLRCICGRGICRLL
  • 2. L12A09188|    From 19 To 76 E-value: 9e-21 Score: 90.5
        QAEARQARADEAAAQQQPGADDQGMAHSFTRPENAALPLSESAKGLRCVCRRGVCQLL
  • 3. L12A09185|    From 28 To 76 E-value: 1e-19 Score: 86.7
        DEAAAQQQPGADDQGMAHSFTWPENAALPLSESAKGLRCVCTRGFCRLL
  • 4. L01A000835    From 28 To 76 E-value: 2e-19 Score: 86.3
        DEAAAQQQPGTDDQGMAHSFTWPENAALPLSESAKGLRCICTRGFCRLL
  • 5. L12A09183|    From 28 To 76 E-value: 4e-18 Score: 81.6
        DEAAIQEQPGADDQGMAHSFTRNESAVLPLSESERGLRCICLLGICRLL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: