Record in detail


General Info

  • lamp_id:L01A000864
  • Name:Sequence 90 from patent US 7166769
  • FullName:Sequence 90 from patent US 7166769
  • Source:Synthetic
  • Mass:6438.4 Da
  • Sequence Length:59 aa
  • Isoelectric Point:8.3
  • Activity:Antimicrobial
  • Sequence
        CGGKCNVRCSKAGQHEECLKYCNICCQKCNCVPSGTFGHKDECPCYRDMKNSKGGSKCP
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000864    From 1 To 59 E-value: 4e-29 Score: 118
        CGGKCNVRCSKAGQHEECLKYCNICCQKCNCVPSGTFGHKDECPCYRDMKNSKGGSKCP
  • 2. L06AT00237    From 5 To 64 E-value: 9e-24 Score: 100
        CGGKCSVRCSKADRTHEECLEDCDICCQKCNCVPSGTYGNKDECPCYRDMKNSKGGSKCP
  • 3. L01A000894    From 30 To 88 E-value: 1e-20 Score: 90.1
        CDSKCAQRCAKAGVQDRCLRFCGICCEKCNCVPSGTYGNKDECPCYRDMKNSKGKDKCP
  • 4. L01A001091    From 30 To 88 E-value: 1e-20 Score: 89.7
        CSSKCSKRCSRAGMKDRCMKFCGICCSKCNCVPSGTYGNKHECPCYRDMKNSKGKAKCP
  • 5. L03A000160    From 30 To 88 E-value: 1e-19 Score: 86.7
        CDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: