Record in detail


General Info

  • lamp_id:L01A000872
  • Name:Sequence 82 from patent US 7166769
  • FullName:Sequence 82 from patent US 7166769
  • Source:Synthetic
  • Mass:7790.9 Da
  • Sequence Length:74 aa
  • Isoelectric Point:8.57
  • Activity:Antimicrobial
  • Sequence
        AAEDSQVGEGVVKIDCGGRCKGRCSKSSRPNLCLRACNSCCYRCNCVPPGTAGNHHLCPCYASITTRGGRLKCP
  • Function:

Cross-Linking

  •   Cross-linking

    •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000872    From 1 To 74 E-value: 5e-38 Score: 147
        AAEDSQVGEGVVKIDCGGRCKGRCSKSSRPNLCLRACNSCCYRCNCVPPGTAGNHHLCPCYASITTRGGRLKCP
  • 2. L01A000871    From 7 To 80 E-value: 5e-25 Score: 104
        AADGAKVGEGVVKIDCGGRCKDRCSKSSRTKLCLRACNSCCSRCNCVPPGTSGNTHLCPCYASITTHGGRLKCP
  • 3. L01A001087    From 26 To 96 E-value: 4e-22 Score: 95.1
        EDPHM-DAAKKIDCGGKCNSRCSKARRQKMCIRACNSCCKKCRCVPPGTSGNRDLCPCYARLTTHGGKLKCP
  • 4. L01A000867    From 22 To 90 E-value: 8e-22 Score: 94
        QHASLLAKIDCGGACKARCRLSSRPHLCKRACGTCCQRCSCVPPGTAGNYDVCPCYATLTTHGGKRKCP
  • 5. L01A000889    From 26 To 99 E-value: 2e-21 Score: 92.4
        SAHAQTQGSLLQQIDCNGACAARCRLSSRPRLCQRACGTCCRRCNCVPPGTAGNQEVCPCYASLTTHGGKRKCP

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments
  •   [1]  wwwwwwwwwwwwwwwwwww
  •   ----  ak0526@163.com   at  2013-08-20 15:05:47
  •   [2]  test4
  •   ----  wuhy@163.com   at  2012-11-29 14:52:14
  •   [3]  test
  •   ----  wuhy@163.com   at  2012-11-29 00:00:00
  •   [4]  test2
  •   ----  ak0526@163.com   at  2012-11-29 00:00:00
  •   [5]  test3
  •   ----  ak0526@163.com   at  2012-11-29 00:00:00



CAPTCHA Image   Reload Image
Enter Code*: