Record in detail


General Info

  • lamp_id:L01A000881
  • Name:Sequence 73 from patent US 7166769
  • FullName:Sequence 73 from patent US 7166769
  • Source:Synthetic
  • Mass:7176.2 Da
  • Sequence Length:66 aa
  • Isoelectric Point:8.57
  • Activity:Antimicrobial
  • Sequence
        HEVQHIDCNAACAARCRLASRQRMCHRACGTCCRRCNCVPPGTSGNQEVCPCYASLATHGGRRKCP
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000881    From 1 To 66 E-value: 4e-33 Score: 131
        HEVQHIDCNAACAARCRLASRQRMCHRACGTCCRRCNCVPPGTSGNQEVCPCYASLATHGGRRKCP
  • 2. L01A000889    From 36 To 99 E-value: 4e-28 Score: 114
        LQQIDCNGACAARCRLSSRPRLCQRACGTCCRRCNCVPPGTAGNQEVCPCYASLTTHGGKRKCP
  • 3. L12A01216|    From 2 To 66 E-value: 7e-25 Score: 104
        SYKKIDCGGACAARCRLSSRPRLCHRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP
  • 4. L12A11355|    From 1 To 65 E-value: 8e-25 Score: 103
        SYKKIDCGGACAARCRLSSRPRLCHRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP
  • 5. L01A002690    From 1 To 66 E-value: 1e-24 Score: 103
        YSYKKIDCGGACAARCRLSSRPRLCNRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: